Aldo-keto Reductase Family 1 Member B1


Background

Catalog Number:

CPTC-AKR1B1-1

Target Antigen:

Aldo-keto Reductase Family 1 Member B1

Isotype:

IgG1

Species:

Mouse Monoclonal Antibody

Last Updated:

12/15/2011

Antigen Recognition(s):

recombinant full-length

Purchase
Characterization Data [Compare Characterization Data]
  Western Blot
Click to enlarge image Western Blot using CPTC-AKR1B1-1 as primary Ab against Ag 10316 (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3). Click image to enlarge

CPTC-AKR1B1-1 Western Blot

Western Blot using CPTC-AKR1B1-1 as primary Ab against Ag 10316 (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).

  Cell Lysate Western Blot
Click to enlarge image Western Blot using CPTC-AKR1B1-1 as primary Ab against cell lysate from TK-10 cells (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3). Click image to enlarge

CPTC-AKR1B1-1 Cell Lysate blot

Western Blot using CPTC-AKR1B1-1 as primary Ab against cell lysate from TK-10 cells (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).

  Indirect ELISA
Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate) Click image to enlarge

CPTC-AKR1B1-1 Indirect ELISA

Indirect ELISA (ie, binding of Antibody to Antigen coated plate)

  Cross Reactivity Data
Click to enlarge image This table shows cross reactivity within the AKR1 family of antigens. Click image to enlarge

Cross Reactivity Data

This table shows cross reactivity within the AKR1 family of antigens.

Characterization SOP Files

  NCI 60 Protein Array
Click to enlarge image Protein Array in which CPTC-AKR1B1-1 is screened against the NCI60 cell line panel for expression. Data is normalized to a mean signal of 1.0 and standard deviation of 0.5. Color conveys over-expression level (green), basal level (blue), under-expression (red). Click image to enlarge

CPTC-AKR1B1-1 NCI 60 Protein Array

Protein Array in which CPTC-AKR1B1-1 is screened against the NCI60 cell line panel for expression. Data is normalized to a mean signal of 1.0 and standard deviation of 0.5. Color conveys over-expression level (green), basal level (blue), under-expression (red).

  IHC NCI60

CPTC-AKR1B1-1 IHC NCI60

Immuno-histochemistry of CPTC-AKR1B1-1 for NCI60 Cell Line Array at titer 1:500
0=NEGATIVE
1=WEAK(RED)
2=MODERATE(BLUE)
3=STRONG(GREEN)

Click to view IHC NCI60 Cell Line Array example
Close

IHC Cell Line Images

IHC NCI60 Cell Line Array example
  IHC Tissue
Click to enlarge image Tissue Micro-Array(TMA) core of lung cancer showing cytoplasmic staining using Antibody CPTC-AKR1B1-1. Titer: 1:500 Click image to enlarge

CPTC-AKR1B1-1 IHC Tissue

Tissue Micro-Array(TMA) core of lung cancer showing cytoplasmic staining using Antibody CPTC-AKR1B1-1. Titer: 1:500

  IHC HPA
Download AKR1B1-1.pdf (464.3 KB)

CPTC-AKR1B1-1 evaluation by the Human Protein Atlas

This PDF provides the evaluation results as provided by the Human Protein Atlas (www.proteinatlas.org).

  IPMS
Download AKR1B1-1.pdf (604.7 KB)

CPTC-AKR1B1-1 Immuno MS

This PDF gives the results of Immuno MS with CPTC-AKR1B1-1 and the AKR1B1 antigen.

  NAPPA
Download AKR1B1-1.pdf (163.0 KB)

Evaluation of antibody by NAPPA

This file shows the reactivity of the antibody with proteins expressed by the NAPPA technique.

Characterization SOP Files

Background

Catalog Number:

CPTC-AKR1B1-2

Target Antigen:

Aldo-keto Reductase Family 1 Member B1

Isotype:

IgG1

Species:

Mouse Monoclonal Antibody

Last Updated:

03/07/2013

Antigen Recognition(s):

recombinant full-length

Purchase
Characterization Data [Compare Characterization Data]
  Western Blot
Click to enlarge image Western Blot using CPTC-AKR1B1-2 as primary Ab against Ag 10316 (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3). Click image to enlarge

CPTC-AKR1B1-2 Western Blot

Western Blot using CPTC-AKR1B1-2 as primary Ab against Ag 10316 (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).

  Cell Lysate Western Blot
Click to enlarge image Western Blot using CPTC-AKR1B1-2 as primary Ab against cell lysate from TK-10 cells (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3). Click image to enlarge

CPTC-AKR1B1-2 Cell Lysate Western Blot

Western Blot using CPTC-AKR1B1-2 as primary Ab against cell lysate from TK-10 cells (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).

  Indirect ELISA
Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate) Click image to enlarge

CPTC-AKR1B1-2 Indirect ELISA

Indirect ELISA (ie, binding of Antibody to Antigen coated plate)

  Cross Reactivity Data
Click to enlarge image This table shows cross reactivity within the AKR1 family of antigens. Click image to enlarge

Cross Reactivity Data

This table shows cross reactivity within the AKR1 family of antigens.

Characterization SOP Files

  NCI 60 Protein Array
Click to enlarge image Protein Array in which CPTC-AKR1B1-2 is screened against the NCI60 cell line panel for expression. Data is normalized to a mean signal of 1.0 and standard deviation of 0.5. Color conveys over-expression level (green), basal level (blue), under-expression level (red). Click image to enlarge

CPTC-AKR1B1-2 NCI 60 Protein Array

Protein Array in which CPTC-AKR1B1-2 is screened against the NCI60 cell line panel for expression. Data is normalized to a mean signal of 1.0 and standard deviation of 0.5. Color conveys over-expression level (green), basal level (blue), under-expression level (red).

  IHC NCI60

CPTC-AKR1B1-2 IHC NCI60

This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.

Click to view IHC NCI60 Cell Line Array example
Close

IHC Cell Line Images

IHC NCI60 Cell Line Array example
  IHC Tissue

CPTC-AKR1B1-2 IHC Tissue

This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.

  IPMS
Download AKR1B1-2.pdf (593.8 KB)

CPTC-AKR1B1-2 Immuno MS

This PDF provides the results of Immuno MS with CPTC-AKR1B1-2 antibody and AKR1B1 antigen.

  NAPPA
Download AKR1B1-2.pdf (1.2 MB)

Evaluation of antibody by NAPPA

This file shows the reactivity of the antibody with proteins expressed by the NAPPA technique.

Characterization SOP Files

Background

Catalog Number:

CPTC-AKR1B1-3

Target Antigen:

Aldo-keto Reductase Family 1 Member B1

Isotype:

IgG1

Species:

Mouse Monoclonal Antibody

Last Updated:

12/15/2011

Antigen Recognition(s):

recombinant full-length

External Links
Purchase
Characterization Data [Compare Characterization Data]
  Western Blot
Click to enlarge image Western Blot using CPTC-AKR1B1-3 as primary Ab against Ag 10316 (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3). Click image to enlarge

CPTC-AKR1B1-3 Western Blot

Western Blot using CPTC-AKR1B1-3 as primary Ab against Ag 10316 (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).

  Cell Lysate Western Blot
Click to enlarge image Western Blot using CPTC-AKR1B1-3 as primary Ab against cell lysate from TK-10 cells (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3). Click image to enlarge

CPTC-AKR1B1-3 Cell Lysate Western Blot

Western Blot using CPTC-AKR1B1-3 as primary Ab against cell lysate from TK-10 cells (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).

  Indirect ELISA
Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate) Click image to enlarge

CPTC-AKR1B1-3 Indirect ELISA

Indirect ELISA (ie, binding of Antibody to Antigen coated plate)

  Cross Reactivity Data
Click to enlarge image This table shows cross reactivity within the AKR1 family of antigens. Click image to enlarge

Cross Reactivity Data

This table shows cross reactivity within the AKR1 family of antigens.

Characterization SOP Files

  NCI 60 Protein Array
Click to enlarge image Protein Array in which CPTC-AKR1B1-3 is screened against the NCI60 cell line panel for expression. Data is normalized to a mean signal of 1.0 and standard deviation of 0.5. Color conveys over-expression level (green), basal level (blue), under-expression level (red). Click image to enlarge

CPTC-AKR1B1-3 Protein Array

Protein Array in which CPTC-AKR1B1-3 is screened against the NCI60 cell line panel for expression. Data is normalized to a mean signal of 1.0 and standard deviation of 0.5. Color conveys over-expression level (green), basal level (blue), under-expression level (red).

  IHC NCI60

CPTC-AKR1B1-3 IHC NCI60

Immuno-histochemistry of CPTC-AKR1B1-3 for NCI60 Cell Line Array at titer 1:250
0=NEGATIVE
1=WEAK
2=MODERATE
3=STRONG

Click to view IHC NCI60 Cell Line Array example
Close

IHC Cell Line Images

IHC NCI60 Cell Line Array example
  IHC Tissue
Click to enlarge image Tissue Micro-Array(TMA) core of lung cancer showing cytoplasmic staining using Antibody CPTC-AKR1B1-3. Titer: 1:250 Click image to enlarge

CPTC-AKR1B1-3 IHC Tissue

Tissue Micro-Array(TMA) core of lung cancer showing cytoplasmic staining using Antibody CPTC-AKR1B1-3. Titer: 1:250

  IHC HPA
Download AKR1B1-3 HPA Report.pdf (139.7 KB)

CPTC-AKR1B1-3 evaluation by the Human Protein Atlas

This PDF provides the evaluation results as provided by the Human Protein Atlas (www.proteinatlas.org).

  IPMS
Download AKR1B1-3.pdf (593.9 KB)

CPTC-AKR1B1-3 Immuno MS

This PDF provides the results of Immuno MS with CPTC-AKR1B1-3 antibody and AKR1B1 antigen.

  NAPPA
Download AKR1B1-3.pdf (1.2 MB)

Evaluation of antibody by NAPPA

This antibody was found to be unsuitable for evaluation by NAPPA because of low reactivity above background.

Characterization SOP Files

Background

NCI Identification Number:

10316

Antigen Name:

Aldo-keto Reductase Family 1 Member B1

CPTC Name:

CPTC-AKR1B1

Keywords:

AKR1B1; ADR; ALDR1; ALR2; AR; EC 1.1.1.21; MGC1804

Function:

This gene encodes a member of the aldo/keto reductase superfamily, which consists of more than 40 known enzymes and proteins. This member catalyzes the reduction of a number of aldehydes, including the aldehyde form of glucose, and is thereby implicated in the development of diabetic
complications by catalyzing the reduction of glucose to sorbitol. There are a few putative
pseudogenes for this gene, and one of them has been confirmed and mapped to chromosome 3.

It functions to catalyze the NADPH-dependent reduction of a wide variety of carbonyl-containing compounds to their corresponding alcohols with a broad range of catalytic efficiencies.

Chromosomal Localization:

7q35

Expression System:

E. Coli

NCBI Accession Number:

BC000260

Swiss Prot Accession Number:

P15121

DNA Source:

HIP:HsCD00003028

Immunogen:

Recombinant Full Length Protein

Vector Name:

pMCSG7

Extinction Coefficient:

49578

Buffers:

50mM NH4HC03

Expressed Sequence:

SNAMASRLLLNNGAKMPILGLGTWKSPPGQVTEAVKVAIDVGYRHIDCAH
VYQNENEVGVAIQEKLREQVVKREELFIVSKLWCTYHEKGLVKGACQKTL
SDLKLDYLDLYLIHWPTGFKPGKEFFPLDESGNVVPSDTNILDTWAAMEE
LVDEGLVKAIGISNFNHLQVEMILNKPGLKYKPAVNQIECHPYLTQEKLI
QYCQSKGIVVTAYSPLGSPDRPWAKPEDPSLLEDPRIKAIAAKHNKTTAQ
VLIRFPMQRNLVVIPKSVTPERIAENFKVFDFELSSQDMTTLLSYNRNWR
VCALLSCTSHKDYPFHEEF

Native Sequence:

MASRLLLNNGAKMPILGLGTWKSPPGQVTEAVKVAIDVGYRHIDCAHVYQ
NENEVGVAIQEKLREQVVKREELFIVSKLWCTYHEKGLVKGACQKTLSDL
KLDYLDLYLIHWPTGFKPGKEFFPLDESGNVVPSDTNILDTWAAMEELVD
EGLVKAIGISNFNHLQVEMILNKPGLKYKPAVNQIECHPYLTQEKLIQYC
QSKGIVVTAYSPLGSPDRPWAKPEDPSLLEDPRIKAIAAKHNKTTAQVLI
RFPMQRNLVVIPKSVTPERIAENFKVFDFELSSQDMTTLLSYNRNWRVCA
LLSCTSHKDYPFHEEF

Calculated Isoelectric Point:

6.51

Molecular Weight:

36126

Last Updated:

11/14/2012

Links

Characterization Data

Gel

Click to enlarge image Tissue Micro-Array(TMA) core of lung cancer showing cytoplasmic staining using Antibody CPTC-AKR1B1-3. Titer: 1:250
Click image to enlarge

Ag 10316

PAGE of Ag 10316 with molecular weight standards

SOPs

Don't have Adobe Reader™?

Get it for free at Adobe.com