PRINT

Aldo-Keto Reductase Family 1 Member B1

Antibody: CPTC-AKR1B1-1
Background

Catalog Number:

CPTC-AKR1B1-1

RRID:

AB_2273742

Target Antigen:

Aldo-Keto Reductase Family 1 Member B1

Isotype:

IgG1

Species:

Mouse Monoclonal Antibody

Last Updated:

05/23/2024

Antigen Recognition(s):

Recombinant Full-length, Endogenous

SOP:

Purchase
Characterization Data [Compare Characterization Data]
  Cross Reactivity Data
Click to enlarge image This table shows cross reactivity within the AKR1 family of antigens. Click image to enlarge

Cross Reactivity Data

Result: Positive

This table shows cross reactivity within the AKR1 family of antigens.


Characterization SOP Files

  CyTOF
Click to enlarge image Imaging mass cytometry on lung cancer tissue core using CPTC-AKR1B1-1 metal-labeled antibody. Data shows overlay of target protein signal (red) and DNA (blue). Dilution: 1:100 of 0.5mg/mL stock. Signal was also obtained in other normal tissues (appendix and kidney) and cancer tissues (breast, lung, and ovarian). Click image to enlarge

CPTC-AKR1B1-1 Immuno-Mass Cytometry

Result: Positive

Imaging mass cytometry on lung cancer tissue core using CPTC-AKR1B1-1 metal-labeled antibody. Data shows overlay of target protein signal (red) and DNA (blue). Dilution: 1:100 of 0.5mg/mL stock. Signal was also obtained in other normal tissues (appendix and kidney) and cancer tissues (breast, lung, and ovarian).


Characterization SOP Files

  IHC HPA
Download This PDF provides the evaluation results as provided by the Human Protein Atlas (www.proteinatlas.org). (464.3 KB)

CPTC-AKR1B1-1 evaluation by the Human Protein Atlas

Result: Positive

This PDF provides the evaluation results as provided by the Human Protein Atlas (www.proteinatlas.org).


Characterization SOP Files

  IHC NCI60
Click to enlarge image Immuno-histochemistry of CPTC-AKR1B1-1 for NCI60 Cell Line Array at titer 1:500 0=NEGATIVE 1=WEAK(RED) 2=MODERATE(BLUE) 3=STRONG(GREEN) Click image to enlarge

CPTC-AKR1B1-1 IHC NCI60

Result: Positive

Immuno-histochemistry of CPTC-AKR1B1-1 for NCI60 Cell Line Array at titer 1:500
0=NEGATIVE
1=WEAK(RED)
2=MODERATE(BLUE)
3=STRONG(GREEN)


Characterization SOP Files

  IHC Tissue
Click to enlarge image Tissue Micro-Array(TMA) core of lung cancer showing cytoplasmic staining using Antibody CPTC-AKR1B1-1. Titer: 1:500 Click image to enlarge

CPTC-AKR1B1-1 IHC Tissue

Result: Positive

Tissue Micro-Array(TMA) core of lung cancer showing cytoplasmic staining using Antibody CPTC-AKR1B1-1. Titer: 1:500


Characterization SOP Files

  IP
Download This PDF gives the results of Immuno MS with CPTC-AKR1B1-1 and the AKR1B1 antigen. (604.7 KB)

CPTC-AKR1B1-1 Immuno MS

Result: Positive

This PDF gives the results of Immuno MS with CPTC-AKR1B1-1 and the AKR1B1 antigen.


Characterization SOP Files

  Indirect ELISA
Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate) Click image to enlarge

CPTC-AKR1B1-1 Indirect ELISA

Result: Positive

Indirect ELISA (ie, binding of Antibody to Antigen coated plate)


Characterization SOP Files

  NAPPA
Download This file shows the reactivity of the antibody with proteins expressed by the NAPPA technique. (163.0 KB)

Evaluation of antibody by NAPPA

Result: Positive

This file shows the reactivity of the antibody with proteins expressed by the NAPPA technique.


Characterization SOP Files

  NCI 60 Protein Array
Click to enlarge image Protein Array in which CPTC-AKR1B1-1 is screened against the NCI60 cell line panel for expression. Data is normalized to a mean signal of 1.0 and standard deviation of 0.5. Color conveys over-expression level (green), basal level (blue), under-expression (red). Click image to enlarge

CPTC-AKR1B1-1 NCI 60 Protein Array

Result: Positive

Protein Array in which CPTC-AKR1B1-1 is screened against the NCI60 cell line panel for expression. Data is normalized to a mean signal of 1.0 and standard deviation of 0.5. Color conveys over-expression level (green), basal level (blue), under-expression (red).


Characterization SOP Files

  Western Blot - Recombinant Protein or Peptide
Click to enlarge image Western Blot using CPTC-AKR1B1-1 as primary Ab against Ag 10316 (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3). Click image to enlarge

CPTC-AKR1B1-1 Western Blot

Result: Positive

Western Blot using CPTC-AKR1B1-1 as primary Ab against Ag 10316 (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).


Characterization SOP Files

  Western Blot - Tissue or Cell Lysate
Click to enlarge image Western Blot using CPTC-AKR1B1-1 as primary Ab against cell lysate from TK-10 cells (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3). Click image to enlarge

CPTC-AKR1B1-1 Cell Lysate blot

Result: Positive

Western Blot using CPTC-AKR1B1-1 as primary Ab against cell lysate from TK-10 cells (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).


Characterization SOP Files

[top]

Antibody: CPTC-AKR1B1-2
Background

Catalog Number:

CPTC-AKR1B1-2

RRID:

AB_1553409

Target Antigen:

Aldo-Keto Reductase Family 1 Member B1

Isotype:

IgG1

Species:

Mouse Monoclonal Antibody

Last Updated:

09/09/2021

Antigen Recognition(s):

Recombinant Full-length

SOP:

Purchase
External Links
Characterization Data [Compare Characterization Data]
  Cross Reactivity Data
Click to enlarge image This table shows cross reactivity within the AKR1 family of antigens. Click image to enlarge

Cross Reactivity Data

Result: Positive

This table shows cross reactivity within the AKR1 family of antigens.


Characterization SOP Files

  IHC HPA
Download This PDF provides the evaluation results as provided by the Human Protein Atlas (www.proteinatlas.org). (106.5 KB)

CPTC-AKR1B1-2 evaluation by the Human Protein Atlas

Result: Positive

This PDF provides the evaluation results as provided by the Human Protein Atlas (www.proteinatlas.org).


Characterization SOP Files

  IHC NCI60

CPTC-AKR1B1-2 IHC NCI60

Result: Negative

This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.


Characterization SOP Files

  IHC Tissue

CPTC-AKR1B1-2 IHC Tissue

Result: Negative

This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.


Characterization SOP Files

  IP
Download This PDF provides the results of Immuno MS with CPTC-AKR1B1-2 antibody and AKR1B1 antigen. (593.8 KB)

CPTC-AKR1B1-2 Immuno MS

Result: Negative

This PDF provides the results of Immuno MS with CPTC-AKR1B1-2 antibody and AKR1B1 antigen.


Characterization SOP Files

  Immunofluorescence - HPA
Click to enlarge image Results provided by the Human Protein Atlas (www.proteinatlas.org). The subcellular location is partly supported by literature or no literature is available. Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm & cytosol. Human assay: A-431 fixed with PFA, dilution: 1:2000 Click image to enlarge

CPTC-AKR1B1-2 Evaluation by the Human Protein Atlas

Result: Positive

Results provided by the Human Protein Atlas (www.proteinatlas.org). The subcellular location is partly supported by literature or no literature is available. Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm & cytosol. Human assay: A-431 fixed with PFA, dilution: 1:2000


Characterization SOP Files

  Indirect ELISA
Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate) Click image to enlarge

CPTC-AKR1B1-2 Indirect ELISA

Result: Positive

Indirect ELISA (ie, binding of Antibody to Antigen coated plate)


Characterization SOP Files

  NAPPA
Download This file shows the reactivity of the antibody with proteins expressed by the NAPPA technique. (1.2 MB)

Evaluation of antibody by NAPPA

Result: Positive

This file shows the reactivity of the antibody with proteins expressed by the NAPPA technique.


Characterization SOP Files

  NCI 60 Protein Array
Click to enlarge image Protein Array in which CPTC-AKR1B1-2 is screened against the NCI60 cell line panel for expression. Data is normalized to a mean signal of 1.0 and standard deviation of 0.5. Color conveys over-expression level (green), basal level (blue), under-expression level (red). Click image to enlarge

CPTC-AKR1B1-2 NCI 60 Protein Array

Result: Positive

Protein Array in which CPTC-AKR1B1-2 is screened against the NCI60 cell line panel for expression. Data is normalized to a mean signal of 1.0 and standard deviation of 0.5. Color conveys over-expression level (green), basal level (blue), under-expression level (red).


Characterization SOP Files

  Western Blot - HPA - tissue or cell lysate
Click to enlarge image Results provided by the Human Protein Atlas (www.proteinatlas.org). Single band corresponding to the predicted size in kDa (+/-20%). Analysis performed using a standard panel of samples. Antibody dilution: 1:500 Click image to enlarge

CPTC-AKR1B1-2 Evaluation by the Human Protein Atlas

Result: Positive

Results provided by the Human Protein Atlas (www.proteinatlas.org). Single band corresponding to the predicted size in kDa (+/-20%). Analysis performed using a standard panel of samples. Antibody dilution: 1:500


Characterization SOP Files

  Western Blot - Recombinant Protein or Peptide
Click to enlarge image Western Blot using CPTC-AKR1B1-2 as primary Ab against Ag 10316 (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3). Click image to enlarge

CPTC-AKR1B1-2 Western Blot

Result: Positive

Western Blot using CPTC-AKR1B1-2 as primary Ab against Ag 10316 (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).


Characterization SOP Files

  Western Blot - Tissue or Cell Lysate
Click to enlarge image Western Blot using CPTC-AKR1B1-2 as primary Ab against cell lysate from TK-10 cells (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3). Click image to enlarge

CPTC-AKR1B1-2 Cell Lysate Western Blot

Result: Positive

Western Blot using CPTC-AKR1B1-2 as primary Ab against cell lysate from TK-10 cells (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).


Characterization SOP Files

[top]

Antibody: CPTC-AKR1B1-3
Background

Catalog Number:

CPTC-AKR1B1-3

RRID:

AB_1553411

Target Antigen:

Aldo-Keto Reductase Family 1 Member B1

Isotype:

IgG1

Species:

Mouse Monoclonal Antibody

Last Updated:

09/11/2024

Antigen Recognition(s):

Recombinant Full-length

SOP:

Purchase
External Links
Publications
Characterization Data [Compare Characterization Data]
  Cross Reactivity Data
Click to enlarge image This table shows cross reactivity within the AKR1 family of antigens. Click image to enlarge

Cross Reactivity Data

Result: Positive

This table shows cross reactivity within the AKR1 family of antigens.


Characterization SOP Files

  IHC HPA
Download This PDF provides the evaluation results as provided by the Human Protein Atlas (www.proteinatlas.org). (139.7 KB)

CPTC-AKR1B1-3 evaluation by the Human Protein Atlas

Result: Positive

This PDF provides the evaluation results as provided by the Human Protein Atlas (www.proteinatlas.org).


Characterization SOP Files

  IHC NCI60
Click to enlarge image Immuno-histochemistry of CPTC-AKR1B1-3 for NCI60 Cell Line Array at titer 1:250 0=NEGATIVE 1=WEAK 2=MODERATE 3=STRONG Click image to enlarge

CPTC-AKR1B1-3 IHC NCI60

Result: Positive

Immuno-histochemistry of CPTC-AKR1B1-3 for NCI60 Cell Line Array at titer 1:250
0=NEGATIVE
1=WEAK
2=MODERATE
3=STRONG


Characterization SOP Files

  IHC Tissue
Click to enlarge image Tissue Micro-Array(TMA) core of lung cancer showing cytoplasmic staining using Antibody CPTC-AKR1B1-3. Titer: 1:250 Click image to enlarge

CPTC-AKR1B1-3 IHC Tissue

Result: Positive

Tissue Micro-Array(TMA) core of lung cancer showing cytoplasmic staining using Antibody CPTC-AKR1B1-3. Titer: 1:250


Characterization SOP Files

  IP
Download This PDF provides the results of Immuno MS with CPTC-AKR1B1-3 antibody and AKR1B1 antigen. (593.9 KB)

CPTC-AKR1B1-3 Immuno MS

Result: Negative

This PDF provides the results of Immuno MS with CPTC-AKR1B1-3 antibody and AKR1B1 antigen.


Characterization SOP Files

  Immunofluorescence - HPA
Click to enlarge image Results provided by the Human Protein Atlas (www.proteinatlas.org). The subcellular location is supported by literature. Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm & cytosol. Human assay: A-431 fixed with PFA, dilution: 1:400 Human assay: U-2 OS fixed with PFA, dilution: 1:400 Human assay: U-251 MG fixed with PFA, dilution: 1:400 Click image to enlarge

CPTC-AKR1B1-3 Evaluation by the Human Protein Atlas

Result: Positive

Results provided by the Human Protein Atlas (www.proteinatlas.org). The subcellular location is supported by literature. Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm & cytosol. Human assay: A-431 fixed with PFA, dilution: 1:400
Human assay: U-2 OS fixed with PFA, dilution: 1:400
Human assay: U-251 MG fixed with PFA, dilution: 1:400


Characterization SOP Files

  Indirect ELISA
Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate) Click image to enlarge

CPTC-AKR1B1-3 Indirect ELISA

Result: Positive

Indirect ELISA (ie, binding of Antibody to Antigen coated plate)


Characterization SOP Files

  NAPPA
Download This antibody was found to be unsuitable for evaluation by NAPPA because of low reactivity above background. (1.2 MB)

Evaluation of antibody by NAPPA

Result: Positive

This antibody was found to be unsuitable for evaluation by NAPPA because of low reactivity above background.


Characterization SOP Files

  NCI 60 Protein Array
Click to enlarge image Protein Array in which CPTC-AKR1B1-3 is screened against the NCI60 cell line panel for expression. Data is normalized to a mean signal of 1.0 and standard deviation of 0.5. Color conveys over-expression level (green), basal level (blue), under-expression level (red). Click image to enlarge

CPTC-AKR1B1-3 Protein Array

Result: Positive

Protein Array in which CPTC-AKR1B1-3 is screened against the NCI60 cell line panel for expression. Data is normalized to a mean signal of 1.0 and standard deviation of 0.5. Color conveys over-expression level (green), basal level (blue), under-expression level (red).


Characterization SOP Files

  Western Blot - HPA - tissue or cell lysate
Click to enlarge image Results provided by the Human Protein Atlas (www.proteinatlas.org). Band of predicted size in kDa (+/-20%) with additional bands present. Analysis performed using a standard panel of samples. Antibody dilution: 1:500 Click image to enlarge

CPTC-AKR1B1-3 Evaluation by the Human Protein Atlas

Result: Positive

Results provided by the Human Protein Atlas (www.proteinatlas.org). Band of predicted size in kDa (+/-20%) with additional bands present. Analysis performed using a standard panel of samples. Antibody dilution: 1:500


Characterization SOP Files

  Western Blot - Recombinant Protein or Peptide
Click to enlarge image Western Blot using CPTC-AKR1B1-3 as primary Ab against Ag 10316 (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3). Click image to enlarge

CPTC-AKR1B1-3 Western Blot

Result: Positive

Western Blot using CPTC-AKR1B1-3 as primary Ab against Ag 10316 (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).


Characterization SOP Files

  Western Blot - Tissue or Cell Lysate
Click to enlarge image Western Blot using CPTC-AKR1B1-3 as primary Ab against cell lysate from TK-10 cells (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3). Click image to enlarge

CPTC-AKR1B1-3 Cell Lysate Western Blot

Result: Positive

Western Blot using CPTC-AKR1B1-3 as primary Ab against cell lysate from TK-10 cells (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).


Characterization SOP Files

[top]

Antigen: Aldo-Keto Reductase Family 1 Member B1

Background

NCI Identification Number:

10316

Antigen Name:

Aldo-Keto Reductase Family 1 Member B1

CPTC Name:

CPTC-AKR1B1

Aliases:

AKR1B1; ADR; ALDR1; ALR2; AR; EC 1.1.1.21; MGC1804

Function:

This gene encodes a member of the aldo/keto reductase superfamily, which consists of more than 40 known enzymes and proteins. This member catalyzes the reduction of a number of aldehydes, including the aldehyde form of glucose, and is thereby implicated in the development of diabetic
complications by catalyzing the reduction of glucose to sorbitol. There are a few putative
pseudogenes for this gene, and one of them has been confirmed and mapped to chromosome 3.

It functions to catalyze the NADPH-dependent reduction of a wide variety of carbonyl-containing compounds to their corresponding alcohols with a broad range of catalytic efficiencies.

Chromosomal Localization:

7q35

Expression System:

E. Coli

Accession Number:

BC000260

UniProt Accession Number:

P15121

DNA Source:

HIP:HsCD00003028

Immunogen:

Recombinant Full Length Protein

Vector Name:

pMCSG7

Extinction Coefficient:

49578

Buffers:

50mM NH4HC03

Expressed Sequence:

SNAMASRLLLNNGAKMPILGLGTWKSPPGQVTEAVKVAIDVGYRHIDCAH
VYQNENEVGVAIQEKLREQVVKREELFIVSKLWCTYHEKGLVKGACQKTL
SDLKLDYLDLYLIHWPTGFKPGKEFFPLDESGNVVPSDTNILDTWAAMEE
LVDEGLVKAIGISNFNHLQVEMILNKPGLKYKPAVNQIECHPYLTQEKLI
QYCQSKGIVVTAYSPLGSPDRPWAKPEDPSLLEDPRIKAIAAKHNKTTAQ
VLIRFPMQRNLVVIPKSVTPERIAENFKVFDFELSSQDMTTLLSYNRNWR
VCALLSCTSHKDYPFHEEF

Native Sequence:

MASRLLLNNGAKMPILGLGTWKSPPGQVTEAVKVAIDVGYRHIDCAHVYQ
NENEVGVAIQEKLREQVVKREELFIVSKLWCTYHEKGLVKGACQKTLSDL
KLDYLDLYLIHWPTGFKPGKEFFPLDESGNVVPSDTNILDTWAAMEELVD
EGLVKAIGISNFNHLQVEMILNKPGLKYKPAVNQIECHPYLTQEKLIQYC
QSKGIVVTAYSPLGSPDRPWAKPEDPSLLEDPRIKAIAAKHNKTTAQVLI
RFPMQRNLVVIPKSVTPERIAENFKVFDFELSSQDMTTLLSYNRNWRVCA
LLSCTSHKDYPFHEEF

Calculated Isoelectric Point:

6.51

Molecular Weight:

36126

Last Updated:

08/22/2020

Links

Characterization Data

Gel

Click to enlarge image PAGE of Ag 10316 with molecular weight standards
Click image to enlarge

Ag 10316

PAGE of Ag 10316 with molecular weight standards

[top]

SOPs

[top]

Don't have Adobe Reader™?

Get it for free at Adobe.com

  [top]