Calcyclin (Prolactin Receptor Associated Protein)


Background

Catalog Number:

CPTC-Calcyclin-1

RRID:

AB_1553421

Target Antigen:

Calcyclin (Prolactin Receptor Associated Protein)

Isotype:

IgG1

Species:

Mouse Monoclonal Antibody

Last Updated:

09/09/2021

Antigen Recognition(s):

Recombinant Full-length, Endogenous

SOP:

Purchase
External Links
Characterization Data [Compare Characterization Data]
  IHC HPA
Download This PDF contains the evaluation results provided by the Human Protein Atlas (www.proteinatlas.org) (174.7 KB)

CPTC-Calcyclin-1 Evaluation by the Human Protein Atlas

Result: Positive

This PDF contains the evaluation results provided by the Human Protein Atlas (www.proteinatlas.org)


  IHC NCI60

CPTC-Calcyclin-1 IHC NCI60

Result: Negative

This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.


  IHC Tissue

CPTC-Calcyclin-1 IHC Tissue

Result: Negative

This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.


  Immunofluorescence - HPA
Click to enlarge image Results provided by the Human Protein Atlas (www.proteinatlas.org). The subcellular location is supported by literature. Immunofluorescent staining of human cell line U-251 MG shows localization to plasma membrane & cytosol. Human assay: A-431 fixed with PFA, dilution: 1:400
Human assay: U-2 OS fixed with PFA, dilution: 1:400
Human assay: U-251 MG fixed with PFA, dilution: 1:400 Click image to enlarge

CPTC-Calcyclin-1 Evaluation by the Human Protein Atlas

Result: Positive

Results provided by the Human Protein Atlas (www.proteinatlas.org). The subcellular location is supported by literature. Immunofluorescent staining of human cell line U-251 MG shows localization to plasma membrane & cytosol. Human assay: A-431 fixed with PFA, dilution: 1:400
Human assay: U-2 OS fixed with PFA, dilution: 1:400
Human assay: U-251 MG fixed with PFA, dilution: 1:400


  Indirect ELISA
Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate) Click image to enlarge

CPTC-Calcyclin Indirect ELISA

Result: Positive

Indirect ELISA (ie, binding of Antibody to Antigen coated plate)


Characterization SOP Files

  NCI 60 Protein Array
Click to enlarge image Protein Array in which CPTC-Calcylin is screened against the NCI60 cell line panel for expression. Data is normalized to a mean signal of 1.0 and standard deviation of 0.5. Color conveys over-expression level (green), basal level (blue), under-expression level (red). Click image to enlarge

CPTC-Calcylin NCI 60 Protein Array

Result: Positive

Protein Array in which CPTC-Calcylin is screened against the NCI60 cell line panel for expression. Data is normalized to a mean signal of 1.0 and standard deviation of 0.5. Color conveys over-expression level (green), basal level (blue), under-expression level (red).


  Western Blot - HPA - tissue or cell lysate
Click to enlarge image Results provided by the Human Protein Atlas (www.proteinatlas.org). Band of predicted size in kDa (+/-20%) with additional bands present. Analysis performed using a standard panel of samples. Antibody dilution: 1:250. Click image to enlarge

CPTC-Calcyclin-1 Evaluation by the Human Protein Atlas

Result: Positive

Results provided by the Human Protein Atlas (www.proteinatlas.org). Band of predicted size in kDa (+/-20%) with additional bands present. Analysis performed using a standard panel of samples. Antibody dilution: 1:250.


  Western Blot - Recombinant Protein or Peptide
Click to enlarge image Western Blot using CPTC-Calcyclin-1 as primary Ab against Ag 10268 (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG as a positive control (lane 3). Click image to enlarge

CPTC-Calcyclin-1 Western Blot

Result: Positive

Western Blot using CPTC-Calcyclin-1 as primary Ab against Ag 10268 (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG as a positive control (lane 3).


  Western Blot - Tissue or Cell Lysate
Click to enlarge image Western Blot using CPTC-Calcyclin-1 as primary Ab against cell lysate from SK-OV3 cells (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3). Click image to enlarge

CPTC-Calcyclin-1 Cell Lysate blot

Result: Positive

Western Blot using CPTC-Calcyclin-1 as primary Ab against cell lysate from SK-OV3 cells (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).


Background

Catalog Number:

CPTC-Calcyclin-2

Target Antigen:

Calcyclin (Prolactin Receptor Associated Protein)

Isotype:

IgG1

Species:

Mouse Monoclonal Antibody

Last Updated:

08/24/2021

Antigen Recognition(s):

Recombinant Full-length, Endogenous

SOP:

Purchase
Characterization Data [Compare Characterization Data]
  IHC HPA
Download This PDF contains the evaluation results provided by the Human Protein Atlas (www.proteinatlas.org) (112.9 KB)

CPTC-Calcyclin-2 Evaluation by the Human Protein Atlas

Result: Positive

This PDF contains the evaluation results provided by the Human Protein Atlas (www.proteinatlas.org)


  IHC NCI60
Click to enlarge image Immuno-histochemistry of CPTC-S100A4-3 for NCI60  Cell Line Array at titer 1:250
0=NEGATIVE
1=WEAK
2=MODERATE
3=STRONG
Click image to enlarge

CPTC-Calcyclin-2 IHC NCI60

Result: Positive

Immuno-histochemistry of CPTC-S100A4-3 for NCI60 Cell Line Array at titer 1:250
0=NEGATIVE
1=WEAK
2=MODERATE
3=STRONG


  Indirect ELISA
Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate) Click image to enlarge

CPTC-Calcyclin-2 Indirect ELISA

Result: Positive

Indirect ELISA (ie, binding of Antibody to Antigen coated plate)


Characterization SOP Files

  NCI 60 Protein Array
Click to enlarge image Protein Array in which CPTC-Calcyclin-2 is screened against the NCI60 cell line panel for expression. Data is normalized to a mean signal of 1.0 and standard deviation of 0.5. Color conveys over-expression level (green), basal level (blue), under-expression level (red). Click image to enlarge

CPTC-Calcyclin-2 NCI60 Protein Array

Result: Positive

Protein Array in which CPTC-Calcyclin-2 is screened against the NCI60 cell line panel for expression. Data is normalized to a mean signal of 1.0 and standard deviation of 0.5. Color conveys over-expression level (green), basal level (blue), under-expression level (red).


  Western Blot - Recombinant Protein or Peptide
Click to enlarge image Western Blot using CPTC-Calcyclin-2 as primary Ab against Ag 10268 (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG as positive control (lane 3). Click image to enlarge

CPTC-Calcyclin-2 Western Blot

Result: Positive

Western Blot using CPTC-Calcyclin-2 as primary Ab against Ag 10268 (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG as positive control (lane 3).


  Western Blot - Tissue or Cell Lysate
Click to enlarge image Western Blot using CPTC-Calcyclin-2 as primary Ab against cell lysate from SK-OV3 cells (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3). Click image to enlarge

CPTC-Calcyclin-2 Cell Lysate Western blot

Result: Positive

Western Blot using CPTC-Calcyclin-2 as primary Ab against cell lysate from SK-OV3 cells (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).


Background

Catalog Number:

CPTC-Calcyclin-3

RRID:

AB_10805145

Target Antigen:

Calcyclin (Prolactin Receptor Associated Protein)

Isotype:

IgG2a

Species:

Mouse Monoclonal Antibody

Last Updated:

09/09/2021

Antigen Recognition(s):

Recombinant Full-length, Endogenous

SOP:

Purchase
External Links
Characterization Data [Compare Characterization Data]
  IHC HPA
Download This PDF contains the evaluation results provided by the Human Protein Atlas (www.proteinatlas.org) (105.6 KB)

CPTC-Calcyclin-3 Evaluation by Human Protein Atlas

Result: Positive

This PDF contains the evaluation results provided by the Human Protein Atlas (www.proteinatlas.org)


  IHC NCI60

CPTC-Calcyclin-3 IHC NCI60

Result: Negative

This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.


  IHC Tissue

CPTC-Calcyclin-3 IHC Tissue

Result: Negative

This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.


  Immunofluorescence - HPA
Click to enlarge image Results provided by the Human Protein Atlas (www.proteinatlas.org). The subcellular location is supported by literature. Immunofluorescent staining of human cell line U-251 MG shows localization to plasma membrane & cytosol. Human assay: U-251 MG fixed with PFA, dilution: 1:4. Click image to enlarge

CPTC-Calcyclin-3 Evaluation by Human Protein Atlas

Result: Positive

Results provided by the Human Protein Atlas (www.proteinatlas.org). The subcellular location is supported by literature. Immunofluorescent staining of human cell line U-251 MG shows localization to plasma membrane & cytosol. Human assay: U-251 MG fixed with PFA, dilution: 1:4.


  Indirect ELISA

CPTC-Calcyclin-3 Indirect ELISA

Result: Positive

This antibody is not suitable for use in an Indirect ELISA format


  NCI 60 Protein Array

CPTC-Calcyclin-3 NCI 60 Protein Array

Result: Negative

This antibody is not suitable for use in a Reverse Phase Protein Array format as described in SOP M-105.


  Western Blot - Recombinant Protein or Peptide
Click to enlarge image Western Blot using CPTC-Calcyclin-3 as primary Ab against Ag 10268 (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG as a positive control (lane 3). Click image to enlarge

CPTC-Calcyclin-3 Western blot

Result: Positive

Western Blot using CPTC-Calcyclin-3 as primary Ab against Ag 10268 (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG as a positive control (lane 3).


  Western Blot - Tissue or Cell Lysate
Click to enlarge image Western Blot using CPTC-Calcyclin-3 as primary Ab against cell lysate from SK-OV3 cells (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3). Click image to enlarge

CPTC-Calcyclin-3 Cell Lysate Western blot

Result: Positive

Western Blot using CPTC-Calcyclin-3 as primary Ab against cell lysate from SK-OV3 cells (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).


Background

NCI Identification Number:

10268

Antigen Name:

Calcyclin (Prolactin Receptor Associated Protein)

CPTC Name:

CPTC-Calcyclin

Aliases:

Calcylin, S100A6; S100 calcium binding protein A6; 2A9; 5B10; CABP; CACY; OTTHUMP00000015472; OTTHUMP00000015473; PRA

Function:

The protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21. This protein may function in stimulation of Ca2+-dependent insulin release, stimulation of prolactin secretion, and exocytosis. Chromosomal rearrangements and altered expression of this gene have been implicated in melanoma.

Chromosomal Localization:

1q21

Expression System:

E. Coli

Accession Number:

BC001431

UniProt Accession Number:

P06703

DNA Source:

HIP:HsCD00002783

Immunogen:

Recombinant Full Length Protein

Vector Name:

pMCSG7

Extinction Coefficient:

4470

Buffers:

50mM NH4HC03

Expressed Sequence:

SNAMACPLDQAIGLLVAIFHKYSGREGDKHTLSKKELKELIQKELTIGSK
LQDAEIARLMEDLDRNKDQEVNFQEYVTFLGALALIYNEALKG

Native Sequence:

MACPLDQAIGLLVAIFHKYSGREGDKHTLSKKELKELIQKELTIGSKLQD
AEIARLMEDLDRNKDQEVNFQEYVTFLGALALIYNEALKG

Calculated Isoelectric Point:

5.32

Molecular Weight:

10452

Last Updated:

09/01/2008

Links

Characterization Data

Gel

Click to enlarge image PAGE of Calcyclin (rAg 10268) with molecular weight standards in lane 1.
Click image to enlarge

CPTC-Calcyclin (rAg 10268) PAGE

PAGE of Calcyclin (rAg 10268) with molecular weight standards in lane 1.

SOPs

Don't have Adobe Reader™?

Get it for free at Adobe.com