Calcyclin (Prolactin Receptor Associated Protein)


Background

Catalog Number:

CPTC-Calcyclin-1

RRID:

AB_1553421

Target Antigen:

Calcyclin (Prolactin Receptor Associated Protein)

Isotype:

IgG1

Species:

Mouse Monoclonal Antibody

Last Updated:

02/28/2025

Antigen Recognition(s):

Recombinant Full-length, Endogenous

SOP:

Purchase
External Links
Characterization Data [Compare Characterization Data]
  CyTOF
Click to enlarge image Imaging mass cytometry on prostate cancer tissue core using CPTC-Calcyclin-1 metal-labeled antibody.  Data shows an overlay of the target protein signal (red) and DNA (blue). Dilution: 1:100 of 0.5mg/mL stock. Signal was also obtained in other normal tissues (bone marrow, spleen, placenta, prostate, colon, pancreas, breast, lung, testis, endometrium, appendix, and kidney) and cancer tissues (breast, colon, ovarian, lung, and prostate). Click image to enlarge

CPTC-Calcyclin-1 Immuno-Mass Cytometry

Result: Positive

Imaging mass cytometry on prostate cancer tissue core using CPTC-Calcyclin-1 metal-labeled antibody. Data shows an overlay of the target protein signal (red) and DNA (blue). Dilution: 1:100 of 0.5mg/mL stock. Signal was also obtained in other normal tissues (bone marrow, spleen, placenta, prostate, colon, pancreas, breast, lung, testis, endometrium, appendix, and kidney) and cancer tissues (breast, colon, ovarian, lung, and prostate).


  IHC HPA
Download This PDF contains the evaluation results provided by the Human Protein Atlas (www.proteinatlas.org) (174.7 KB)

CPTC-Calcyclin-1 IHC evaluation by the Human Protein Atlas

Result: Positive

This PDF contains the evaluation results provided by the Human Protein Atlas (www.proteinatlas.org)


  IHC NCI60

CPTC-Calcyclin-1 IHC NCI60

Result: Negative

This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.


  IHC Tissue

CPTC-Calcyclin-1 IHC Tissue

Result: Negative

This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.


  Immunofluorescence - HPA
Click to enlarge image Results provided by the Human Protein Atlas (www.proteinatlas.org). The subcellular location is supported by literature. Immunofluorescent staining of human cell line U-251 MG shows localization to plasma membrane & cytosol. Human assay: A-431 fixed with PFA, dilution: 1:400
Human assay: U-2 OS fixed with PFA, dilution: 1:400
Human assay: U-251 MG fixed with PFA, dilution: 1:400 Click image to enlarge

CPTC-Calcyclin-1 IF evaluation by the Human Protein Atlas

Result: Positive

Results provided by the Human Protein Atlas (www.proteinatlas.org). The subcellular location is supported by literature. Immunofluorescent staining of human cell line U-251 MG shows localization to plasma membrane & cytosol. Human assay: A-431 fixed with PFA, dilution: 1:400
Human assay: U-2 OS fixed with PFA, dilution: 1:400
Human assay: U-251 MG fixed with PFA, dilution: 1:400


  Indirect ELISA
Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate) Click image to enlarge

CPTC-Calcyclin Indirect ELISA

Result: High Binding

Indirect ELISA (ie, binding of Antibody to Antigen coated plate)


Characterization SOP Files

  NCI 60 Protein Array
Click to enlarge image Protein Array in which CPTC-Calcylin is screened against the NCI60 cell line panel for expression. Data is normalized to a mean signal of 1.0 and standard deviation of 0.5. Color conveys over-expression level (green), basal level (blue), under-expression level (red). Click image to enlarge

CPTC-Calcylin NCI 60 Protein Array

Result: Positive

Protein Array in which CPTC-Calcylin is screened against the NCI60 cell line panel for expression. Data is normalized to a mean signal of 1.0 and standard deviation of 0.5. Color conveys over-expression level (green), basal level (blue), under-expression level (red).


  Western Blot - HPA - tissue or cell lysate
Click to enlarge image Results provided by the Human Protein Atlas (www.proteinatlas.org). Band of predicted size in kDa (+/-20%) with additional bands present. Analysis performed using a standard panel of samples. Antibody dilution: 1:250. Click image to enlarge

CPTC-Calcyclin-1 Western Blot evaluation by the Human Protein Atlas

Result: Positive

Results provided by the Human Protein Atlas (www.proteinatlas.org). Band of predicted size in kDa (+/-20%) with additional bands present. Analysis performed using a standard panel of samples. Antibody dilution: 1:250.


  Western Blot - Recombinant Protein or Peptide
Click to enlarge image Western Blot using CPTC-Calcyclin-1 as primary Ab against Ag 10268 (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG as a positive control (lane 3). Click image to enlarge

CPTC-Calcyclin-1 Western Blot (Recombinant Protein)

Result: Positive

Western Blot using CPTC-Calcyclin-1 as primary Ab against Ag 10268 (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG as a positive control (lane 3).


  Western Blot - Tissue or Cell Lysate
Click to enlarge image Western Blot using CPTC-Calcyclin-1 as primary Ab against cell lysate from SK-OV3 cells (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3). Click image to enlarge

CPTC-Calcyclin-1 Western Blot (Cell Lysate)

Result: Positive

Western Blot using CPTC-Calcyclin-1 as primary Ab against cell lysate from SK-OV3 cells (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).


Background

Catalog Number:

CPTC-Calcyclin-2

Target Antigen:

Calcyclin (Prolactin Receptor Associated Protein)

Isotype:

IgG1

Species:

Mouse Monoclonal Antibody

Last Updated:

02/28/2025

Antigen Recognition(s):

Recombinant Full-length, Endogenous

SOP:

Purchase
Characterization Data [Compare Characterization Data]
  CyTOF
Click to enlarge image Imaging mass cytometry on breast cancer tissue core using CPTC-Calcyclin-2  metal-labeled antibody.  Data shows overlay of target protein signal (red) and DNA (blue). Dilution: 1:100 of 0.5mg/mL stock. Signal was also obtained in other normal tissues (Bone Marrow,  Spleen,  Placenta, Prostate, Colon, Pancreas, Breast, Lung, Testis, Endometrium, Appendix, Kidney) and cancer tissues (Colon, Ovarian, Lung, Prostate). Click image to enlarge

CPTC-Calcyclin-2 Immuno-Mass Cytometry

Result: Positive

Imaging mass cytometry on breast cancer tissue core using CPTC-Calcyclin-2 metal-labeled antibody. Data shows overlay of target protein signal (red) and DNA (blue). Dilution: 1:100 of 0.5mg/mL stock. Signal was also obtained in other normal tissues (Bone Marrow, Spleen, Placenta, Prostate, Colon, Pancreas, Breast, Lung, Testis, Endometrium, Appendix, Kidney) and cancer tissues (Colon, Ovarian, Lung, Prostate).


  IHC HPA
Download This PDF contains the evaluation results provided by the Human Protein Atlas (www.proteinatlas.org) (112.9 KB)

CPTC-Calcyclin-2 IHC evaluation by the Human Protein Atlas

Result: Positive

This PDF contains the evaluation results provided by the Human Protein Atlas (www.proteinatlas.org)


  IHC NCI60
Click to enlarge image Immuno-histochemistry of CPTC-S100A4-3 for NCI60  Cell Line Array at titer 1:250
0=NEGATIVE
1=WEAK
2=MODERATE
3=STRONG
Click image to enlarge

CPTC-Calcyclin-2 IHC NCI60

Result: Positive

Immuno-histochemistry of CPTC-S100A4-3 for NCI60 Cell Line Array at titer 1:250
0=NEGATIVE
1=WEAK
2=MODERATE
3=STRONG


  Indirect ELISA
Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate) Click image to enlarge

CPTC-Calcyclin-2 Indirect ELISA

Result: High Binding

Indirect ELISA (ie, binding of Antibody to Antigen coated plate)


Characterization SOP Files

  NCI 60 Protein Array
Click to enlarge image Protein Array in which CPTC-Calcyclin-2 is screened against the NCI60 cell line panel for expression. Data is normalized to a mean signal of 1.0 and standard deviation of 0.5. Color conveys over-expression level (green), basal level (blue), under-expression level (red). Click image to enlarge

CPTC-Calcyclin-2 NCI60 Protein Array

Result: Positive

Protein Array in which CPTC-Calcyclin-2 is screened against the NCI60 cell line panel for expression. Data is normalized to a mean signal of 1.0 and standard deviation of 0.5. Color conveys over-expression level (green), basal level (blue), under-expression level (red).


  Western Blot - Recombinant Protein or Peptide
Click to enlarge image Western Blot using CPTC-Calcyclin-2 as primary Ab against Ag 10268 (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG as positive control (lane 3). Click image to enlarge

CPTC-Calcyclin-2 Western Blot (Recombinant Protein)

Result: Positive

Western Blot using CPTC-Calcyclin-2 as primary Ab against Ag 10268 (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG as positive control (lane 3).


  Western Blot - Tissue or Cell Lysate
Click to enlarge image Western Blot using CPTC-Calcyclin-2 as primary Ab against cell lysate from SK-OV3 cells (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3). Click image to enlarge

CPTC-Calcyclin-2 Western Blot (Cell Lysate)

Result: Positive

Western Blot using CPTC-Calcyclin-2 as primary Ab against cell lysate from SK-OV3 cells (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).


Background

Catalog Number:

CPTC-Calcyclin-3

RRID:

AB_10805145

Target Antigen:

Calcyclin (Prolactin Receptor Associated Protein)

Isotype:

IgG2a

Species:

Mouse Monoclonal Antibody

Last Updated:

02/28/2025

Antigen Recognition(s):

Recombinant Full-length, Endogenous

SOP:

Purchase
External Links
Characterization Data [Compare Characterization Data]
  IHC HPA
Download This PDF contains the evaluation results provided by the Human Protein Atlas (www.proteinatlas.org) (105.6 KB)

CPTC-Calcyclin-3 IHC evaluation by Human Protein Atlas

Result: Positive

This PDF contains the evaluation results provided by the Human Protein Atlas (www.proteinatlas.org)


  IHC NCI60

CPTC-Calcyclin-3 IHC NCI60

Result: Negative

This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.


  IHC Tissue

CPTC-Calcyclin-3 IHC Tissue

Result: Negative

This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.


  Immunofluorescence - HPA
Click to enlarge image Results provided by the Human Protein Atlas (www.proteinatlas.org). The subcellular location is supported by literature. Immunofluorescent staining of human cell line U-251 MG shows localization to plasma membrane & cytosol. Human assay: U-251 MG fixed with PFA, dilution: 1:4. Click image to enlarge

CPTC-Calcyclin-3 IF evaluation by Human Protein Atlas

Result: Positive

Results provided by the Human Protein Atlas (www.proteinatlas.org). The subcellular location is supported by literature. Immunofluorescent staining of human cell line U-251 MG shows localization to plasma membrane & cytosol. Human assay: U-251 MG fixed with PFA, dilution: 1:4.


  Indirect ELISA

CPTC-Calcyclin-3 Indirect ELISA

Result: High Binding

This antibody is not suitable for use in an Indirect ELISA format


  NCI 60 Protein Array

CPTC-Calcyclin-3 NCI 60 Protein Array

Result: Negative

This antibody is not suitable for use in a Reverse Phase Protein Array format as described in SOP M-105.


  Western Blot - Recombinant Protein or Peptide
Click to enlarge image Western Blot using CPTC-Calcyclin-3 as primary Ab against Ag 10268 (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG as a positive control (lane 3). Click image to enlarge

CPTC-Calcyclin-3 Western Blot (Recombinant Protein)

Result: Positive

Western Blot using CPTC-Calcyclin-3 as primary Ab against Ag 10268 (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG as a positive control (lane 3).


  Western Blot - Tissue or Cell Lysate
Click to enlarge image Western Blot using CPTC-Calcyclin-3 as primary Ab against cell lysate from SK-OV3 cells (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3). Click image to enlarge

CPTC-Calcyclin-3 Western Blot (Cell Lysate)

Result: Positive

Western Blot using CPTC-Calcyclin-3 as primary Ab against cell lysate from SK-OV3 cells (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).


Background

NCI Identification Number:

10268

Antigen Name:

Calcyclin (Prolactin Receptor Associated Protein)

CPTC Name:

CPTC-Calcyclin

Aliases:

Calcylin, S100A6; S100 calcium binding protein A6; 2A9; 5B10; CABP; CACY; OTTHUMP00000015472; OTTHUMP00000015473; PRA

Function:

The protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21. This protein may function in stimulation of Ca2+-dependent insulin release, stimulation of prolactin secretion, and exocytosis. Chromosomal rearrangements and altered expression of this gene have been implicated in melanoma.

Chromosomal Localization:

1q21

Expression System:

E. Coli

Accession Number:

BC001431

UniProt Accession Number:

P06703

DNA Source:

HIP:HsCD00002783

Immunogen:

Recombinant Full Length Protein

Vector Name:

pMCSG7

Extinction Coefficient:

4470

Buffers:

50mM NH4HC03

Expressed Sequence:

SNAMACPLDQAIGLLVAIFHKYSGREGDKHTLSKKELKELIQKELTIGSK
LQDAEIARLMEDLDRNKDQEVNFQEYVTFLGALALIYNEALKG

Native Sequence:

MACPLDQAIGLLVAIFHKYSGREGDKHTLSKKELKELIQKELTIGSKLQD
AEIARLMEDLDRNKDQEVNFQEYVTFLGALALIYNEALKG

Calculated Isoelectric Point:

5.32

Molecular Weight:

10452

Last Updated:

09/01/2008

Links

Characterization Data

Gel

Click to enlarge image PAGE of Calcyclin (rAg 10268) with molecular weight standards in lane 1.
Click image to enlarge

CPTC-Calcyclin (rAg 10268) PAGE

PAGE of Calcyclin (rAg 10268) with molecular weight standards in lane 1.

SOPs

Don't have Adobe Reader™?

Get it for free at Adobe.com