BCL2 like 1


Background

Catalog Number:

CPTC-BCL2L1-1

RRID:

AB_10805150

Target Antigen:

BCL2 like 1

Isotype:

IgG2a

Species:

Mouse Monoclonal Antibody

Last Updated:

02/26/2025

Antigen Recognition(s):

Recombinant Full-length

Purchase
Characterization Data [Compare Characterization Data]
  Affinity Measurement by SPR
Download These are the results of SPR pairing experiments with BCL2L1 antibodies. (791.8 KB)

CPTC-BCL2L1-1 Affinity and Kinetics (Surface Plasmon Resonance)

Result: High Binding

These are the results of SPR pairing experiments with BCL2L1 antibodies.


  IHC HPA
Download This PDF contains the evaluation results provided by the Human Protein Atlas (www.proteinatlas.org) (525.9 KB)

CPTC-BCL2L1-1 IHC evaluation by the Human Protein Atlas

Result: Negative

This PDF contains the evaluation results provided by the Human Protein Atlas (www.proteinatlas.org)


  IHC NCI60

CPTC-BCL2L1-1 IHC NCI60

Result: Negative

This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.


  IHC Tissue

CPTC-BCL2L1-1 IHC Tissue

Result: Negative

This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.


  Immunofluorescence - HPA
Download This PDF contains the evaluation results provided by the Human Protein Atlas (www.proteinatlas.org) (525.9 KB)

CPTC-BCL2L1-1 IF evaluation by the Human Protein Atlas

Result: Negative

This PDF contains the evaluation results provided by the Human Protein Atlas (www.proteinatlas.org)


  Indirect ELISA
Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding. Click image to enlarge

CPTC-BCL2L1-1 Indirect ELISA

Result: High Binding

Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding.


Characterization SOP Files

  NCI 60 Protein Array

CPTC-BCL2L1-1 NCI 60 Protein Array

Result: Negative

This antibody is not suitable for use in a Reverse Phase Protein Array format as described in SOP M-105.


  Western Blot - Recombinant Protein or Peptide
Click to enlarge image Western Blot using CPTC-BCL2L1-1 as primary Ab against BCL2L1 (rAg 10650) in lane 2. Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3). Click image to enlarge

CPTC-BCL2L1-1 Western Blot (Recombinant Protein)

Result: Positive

Western Blot using CPTC-BCL2L1-1 as primary Ab against BCL2L1 (rAg 10650) in lane 2. Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).


Background

Catalog Number:

CPTC-BCL2L1-2

RRID:

AB_10804669

Target Antigen:

BCL2 like 1

Isotype:

IgG2b

Species:

Mouse Monoclonal Antibody

Last Updated:

02/26/2025

Antigen Recognition(s):

Recombinant Full-length, Endogenous

Purchase
Characterization Data [Compare Characterization Data]
  Affinity Measurement by SPR
Download These are the results of SPR pairing experiments with BCL2L1 antibodies. (791.8 KB)

CPTC-BCL2L1-2 Affinity and Kinetics (Surface Plasmon Resonance)

Result: High Binding

These are the results of SPR pairing experiments with BCL2L1 antibodies.


  IHC HPA
Download This PDF contains the evaluation results provided by the Human Protein Atlas (www.proteinatlas.org) (821.3 KB)

CPTC-BCL2L1-2 IHC evaluation by the Human Protein Atlas

Result: Negative

This PDF contains the evaluation results provided by the Human Protein Atlas (www.proteinatlas.org)


  IHC NCI60

CPTC-BCL2L1-2 IHC NCI60

Result: Negative

This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.


  IHC Tissue

CPTC-BCL2L1-2 IHC Tissue

Result: Negative

This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.


  Immunofluorescence - HPA
Download This PDF contains the evaluation results provided by the Human Protein Atlas (www.proteinatlas.org) (821.3 KB)

CPTC-BCL2L1-2 IF evaluation by the Human Protein Atlas

Result: Positive

This PDF contains the evaluation results provided by the Human Protein Atlas (www.proteinatlas.org)


  Indirect ELISA
Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding. Click image to enlarge

CPTC-BCL2L1-2 Indirect ELISA

Result: High Binding

Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding.


Characterization SOP Files

  NCI 60 Protein Array

CPTC-BCL2L1-2 NCI 60 Protein Array

Result: Negative

This antibody is not suitable for use in a Reverse Phase Protein Array format as described in SOP M-105.


  Western Blot - Recombinant Protein or Peptide
Click to enlarge image Western Blot using CPTC-BCL2L1-2 as primary Ab against BCL2L1 (rAg 10650) in lane 2. Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3). Click image to enlarge

CPTC-BCL2L1-2 Western blot (Recombinant Protein)

Result: Positive

Western Blot using CPTC-BCL2L1-2 as primary Ab against BCL2L1 (rAg 10650) in lane 2. Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).


Background

Catalog Number:

CPTC-BCL2L1-3

RRID:

AB_10805874

Target Antigen:

BCL2 like 1

Isotype:

IgG2b

Species:

Mouse Monoclonal Antibody

Last Updated:

02/26/2025

Antigen Recognition(s):

Recombinant Full-length, Endogenous

Purchase
Characterization Data [Compare Characterization Data]
  Affinity Measurement by SPR
Download These are the results of SPR pairing experiments with BCL2L1 antibodies. (791.8 KB)

CPTC-BCL2L1-3 Affinity and Kinetics (Surface Plasmon Resonance)

Result: High Binding

These are the results of SPR pairing experiments with BCL2L1 antibodies.


  IHC HPA
Download This PDF contains the evaluation results provided by the Human Protein Atlas (www.proteinatlas.org) (454.3 KB)

CPTC-BCL2L1-3 IHC evaluation by the Human Protein Atlas

Result: Negative

This PDF contains the evaluation results provided by the Human Protein Atlas (www.proteinatlas.org)


  IHC NCI60

CPTC-BCL2L1-3 IHC NCI60

Result: Negative

This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.


  IHC Tissue

CPTC-BCL2L1-3 IHC Tissue

Result: Negative

This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.


  Immunofluorescence - HPA
Download This PDF contains the evaluation results provided by the Human Protein Atlas (www.proteinatlas.org) (454.3 KB)

CPTC-BCL2L1-3 IF evaluation by the Human Protein Atlas

Result: Positive

This PDF contains the evaluation results provided by the Human Protein Atlas (www.proteinatlas.org)


  Indirect ELISA
Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding. Click image to enlarge

CPTC-BCL2L1-3 Indirect ELISA

Result: High Binding

Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding.


Characterization SOP Files

  NCI 60 Protein Array

CPTC-BCL2L1-3 NCI 60 Protein Array

Result: Negative

This antibody is not suitable for use in a Reverse Phase Protein Array format as described in SOP M-105.


  Western Blot - Recombinant Protein or Peptide
Click to enlarge image Western Blot using CPTC-BCL2L1-3 as primary Ab against BCL2L1 (rAg 10650) in lane 2. Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3). Click image to enlarge

CPTC-BCL2L1-3 Western Blot (Recombinant Protein)

Result: Positive

Western Blot using CPTC-BCL2L1-3 as primary Ab against BCL2L1 (rAg 10650) in lane 2. Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).


Background

NCI Identification Number:

10650

Antigen Name:

BCL2 like 1

CPTC Name:

CPTC-BCL2L1

Aliases:

BCL2-like 1; BCLX; BCL2L; bcl-xL; Bcl-S; bcl-xS; Apoptosis regulator Bcl-X; BCLXL; BCLXS; BCL-XL/S; bcl2-L-1; bcl-2-like protein 1; Bcl2-L-1

Function:

Potent inhibitor of cell death. Inhibits activation of caspases (By similarity). Appears to regulate cell
death by blocking the voltage-dependent anion channnel (VDAC) by binding to it and preventing the release of the
caspase activator, CYC1, from the mitochondrial membrane

The protein encoded by this gene belongs to the BCL-2 protein family. BCL-2 family members form hetero- or homodimers and act as anti- or pro-apoptotic regulators that are involved in a wide variety of cellular activities. The proteins encoded by this gene are located at the outer mitochondrial membrane, and have been shown to regulate outer mitochondrial membrane channel (VDAC) opening. VDAC regulates mitochondrial membrane potential, and thus controls the
production of reactive oxygen species and release of cytochrome C by mitochondria, both of which are the potent inducers of cell apoptosis. Two alternatively spliced transcript variants, which encode distinct isoforms, have been reported. The longer isoform acts as an apoptotic inhibitor and the shorter form acts as an apoptotic activator.

Bcl-2 family proteins regulate and contribute to programmed cell death or apoptosis. It is a large protein family and all members contain at least one of four BH (bcl-2 homology) domains. Certain members such as Bcl-2, Bcl-xl and Mcl1 are anti-apoptotic, whilst others are pro-apoptotic. The pro-apoptotic group of Bcl-2 proteins can be further sub-divided into the structurally diverse 'BH3' only proteins (e.g. Bid, Noxa, Puma and Bad) and the multidomain proteins that share BH1 to 3 (e.g. Bax and Bak). Most Bcl-2 family members contain a C-terminal transmembrane domain that functions to target these proteins to the outer mitochondrial and other intracellular membranes.

Chromosomal Localization:

20q11.21

Expression System:

E. Coli

Accession Number:

BC019307.1

UniProt Accession Number:

Q07817

DNA Source:

DNASU - HsCD00004711

Immunogen:

Recombinant Full Length Protein

Vector Name:

pMCSG7

Extinction Coefficient:

41940

Buffers:

PBS without Ca++ and Mg++

Expressed Sequence:

SNAMSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESEMET
PSAINGNPSWHLADSPAVNGATGHSSSLDAREVIPMAAVKQALREAGDEF
ELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFG
GALCVESVDKEMQVLVSRIAAWMATYLNDHLEPWIQENGGWDTFVELYGN
NAAAESRKGQERF

Native Sequence:

MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESEMETPSA
INGNPSWHLADSPAVNGATGHSSSLDAREVIPMAAVKQALREAGDEFELR
YRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGAL
CVESVDKEMQVLVSRIAAWMATYLNDHLEPWIQENGGWDTFVELYGNNAA
AESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK

Calculated Isoelectric Point:

4.65

Molecular Weight:

23786

Last Updated:

05/04/2011

Links

Characterization Data

Gel

Click to enlarge image PAGE of BCL2L2 (rAg 10650) with molecular weight standards in lane 1
Click image to enlarge

CPTC-BCL2L1 PAGE

PAGE of BCL2L2 (rAg 10650) with molecular weight standards in lane 1

No SOPs available.

SOPs

Don't have Adobe Reader™?

Get it for free at Adobe.com