Skip to Content

Nucleoside Diphosphate Kinase B

Antibody: CPTC-NME2-1

Background

Catalog Number:
CPTC-NME2-1
Target Antigen:
Nucleoside Diphosphate Kinase B
Isotype:
IgG2a
Species:
Mouse
Last Updated:
12/16/2011
Antigen Recognition(s):
recombinant full-length

Purchase

Characterization Data [Compare Characterization Data]

Western Blot

Click to enlarge image Western Blot Using CPTC-NME2-1 as primary Ab against Ag 10385(Lane 2). Also included are Molecular Weight markers (Lane 1) and mouse IgG positive control (Lane 3).
Click to enlarge

CPTC-NME2-1 Western Blot

Western Blot Using CPTC-NME2-1 as primary Ab against Ag 10385(Lane 2). Also included are Molecular Weight markers (Lane 1) and mouse IgG positive control (Lane 3).

Indirect ELISA

Click to enlarge image Indirect ELISA of CPTC-NME2-1
Click to enlarge

CPTC-NME2-1 ELISA

Indirect ELISA of CPTC-NME2-1

Cross Reactivity Data

Click to enlarge image This table shows the cross reactivity between NME1 and NME2.
Click to enlarge

Cross Reactivity Studies

This table shows the cross reactivity between NME1 and NME2.

Characterization SOP Files

SPR

Click to enlarge image Kinetic titration data for NME2-1 Ab (606A1.1) using Biacore SPR method
Click to enlarge

CPTC-NME2-1 SPR

Kinetic titration data for NME2-1 Ab (606A1.1) using Biacore SPR method

Immuno-MS

Download NME2-1.pdf (123.0 KB)

CPTC-NME2-1 Immuno-MS

This PDF contains the spectra and recommendation for use of this antibody in immuno capture mass spectrometry.

Antibody: CPTC-NME2-2

Background

Catalog Number:
CPTC-NME2-2
Target Antigen:
Nucleoside Diphosphate Kinase B
Isotype:
IgG2a
Species:
Mouse
Last Updated:
01/24/2012
Antigen Recognition(s):
recombinant full-length

Purchase

Characterization Data [Compare Characterization Data]

Western Blot

Click to enlarge image Western Blot Using CPTC-NME2-2 as primary Ab against Ag 10385(Lane 2). Also included are Molecular Weight markers (Lane 1) and mouse IgG positive control (Lane 3).
Click to enlarge

CPTC-NME2-2 Western Blot

Western Blot Using CPTC-NME2-2 as primary Ab against Ag 10385(Lane 2). Also included are Molecular Weight markers (Lane 1) and mouse IgG positive control (Lane 3).

Indirect ELISA

Click to enlarge image Indirect ELISA of CPTC-NME2-2
Click to enlarge

CPTC-NME2-2 ELISA

Indirect ELISA of CPTC-NME2-2

Cross Reactivity Data

Click to enlarge image This table shows the cross reactivity between NME1 and NME2.
Click to enlarge

Cross Reactivity Studies

This table shows the cross reactivity between NME1 and NME2.

Characterization SOP Files

NCI 60 Protein Array

Click to enlarge image Protein Array in which CPTC-NME2-2 is screened against the NCI60 cell line panel for expression. Data is normalized to a mean signal of 1.0 and standard deviation of 0.5. Color conveys over-expression level (green), basal level (blue), under-expression level (red).
Click to enlarge

CPTC-NME2-2 Protein Array

Protein Array in which CPTC-NME2-2 is screened against the NCI60 cell line panel for expression. Data is normalized to a mean signal of 1.0 and standard deviation of 0.5. Color conveys over-expression level (green), basal level (blue), under-expression level (red).

IHC NCI60

Click to enlarge image Immunohistochemistry of CPTC-NME2-2 for NCI60 Cell Line Array. Data scored as:
0=NEGATIVE
1=WEAK (red)
2=MODERATE (blue)
3=STRONG (green)
Titer: 1:50
Click to enlarge

CPTC-NME2-2 IHC NCI60

Immunohistochemistry of CPTC-NME2-2 for NCI60 Cell Line Array. Data scored as:
0=NEGATIVE
1=WEAK (red)
2=MODERATE (blue)
3=STRONG (green)
Titer: 1:50

Click to view IHC NCI60 Cell Line Array example

SPR

Click to enlarge image Kinetic titration data for NME2-2 Ab (606A13.1) using Biacore SPR method
Click to enlarge

CPTC-NME2-2 SPR

Kinetic titration data for NME2-2 Ab (606A13.1) using Biacore SPR method

Immuno-MS

Download NME2-2.pdf (118.8 KB)

CPTC-NME2-2 Immuno-MS

This PDF contains the spectra and recommendations for the use of this antibody in immuno capture mass spectrometry.

Antibody: CPTC-NME2-3

Background

Catalog Number:
CPTC-NME2-3
Target Antigen:
Nucleoside Diphosphate Kinase B
Isotype:
IgG2b
Species:
Mouse
Last Updated:
01/24/2012
Antigen Recognition(s):
recombinant full-length

Purchase

Characterization Data [Compare Characterization Data]

Western Blot

Click to enlarge image Western Blot Using CPTC-NME2-3 as primary Ab against Ag 10385(Lane 2). Also included are Molecular Weight markers (Lane 1) and mouse IgG positive control (Lane 3).
Click to enlarge

CPTC-NME2-3 Western Blot

Western Blot Using CPTC-NME2-3 as primary Ab against Ag 10385(Lane 2). Also included are Molecular Weight markers (Lane 1) and mouse IgG positive control (Lane 3).

Indirect ELISA

Click to enlarge image Indirect ELISA of CPTC-NME2-3
Click to enlarge

CPTC-NME2-3 Indirect ELISA

Indirect ELISA of CPTC-NME2-3

Cross Reactivity Data

Click to enlarge image This table shows the cross reactivity between NME1 and NME2.
Click to enlarge

Cross Reactivity Studies

This table shows the cross reactivity between NME1 and NME2.

Characterization SOP Files

SPR

Click to enlarge image Kinetic titration data for NME2-3 Ab (606A21.1) using Biacore SPR method
Click to enlarge

CPTC-NME2-3 SPR

Kinetic titration data for NME2-3 Ab (606A21.1) using Biacore SPR method

Immuno-MS

Download NME2-3.pdf (125.8 KB)

CPTC-NME2-3 Immuno-MS

This PDF contains the spectra and recommendation for use of this antibody in immuno capture mass spectrometry.

Antigen: Nucleoside Diphosphate Kinase B

Background

NCI Identification Number:
10385
Antigen Name:
Nucleoside Diphosphate Kinase B
CPTC Name:
CPTC-NME2
Keywords:
Nucleoside Diphosphate Kinase B; NME2; NM23B; EC2.7.4.6; MGC111212; NDPKB; NM23-H2;
Function:
Major role in the synthesis of nucleoside triphosphates other than ATP. Negatively regulates Rho activity by interacting with AKAP13/LBC.

Acts as a transcriptional activator of the c-Myc gene; binds DNA nonspecifically
Chromosomal Localization:
17q21 - q22
Expression System:
E. Coli
NCBI Accession Number:
BC002476
Swiss Prot Accession Number:
P22392
DNA Source:
HIP:HsCD00002962
Immunogen:
Recombinant Full Length Protein
Vector Name:
pMCSG7
Extinction Coefficient:
22523
Buffers:
50mM NH4HC03
Expressed Sequence:
SNAMANLERTFIAIKPDGVQRGLVGEIIKRF
EQKGFRLVAMKFLRASEEHLKQHYIDLKDRP
FFPGLVKYMNSGPVVAMVWEGLNVVKTGRVM
LGETNPADSKPGTIRGDFCIQVGRNIIHGSD
SVKSAEKEISLWFKPEELVDYKSCAHDWVYE
Native Sequence:
MANLERTFIAIKPDGVQRGLVGEIIKRFEQK
GFRLVAMKFLRASEEHLKQHYIDLKDRPFFP
GLVKYMNSGPVVAMVWEGLNVVKTGRVMLGE
TNPADSKPGTIRGDFCIQVGRNIIHGSDSVK
SAEKEISLWFKPEELVDYKSCAHDWVYE
Calculated Isoelectric Point:
8.52
Molecular Weight:
17570
Last Updated:
11/14/2012

Links

Characterization Data

Gel

Click to enlarge image Kinetic titration data for NME2-3 Ab (606A21.1) using Biacore SPR method
Click to enlarge

PAGE of ANL antigen 10385

Electrophoresis of antigen. Lane 1 has molecular weight markers, lane 2 has the antigen.

SOPs

Adobe Reader™ required.

Get Adobe Reader for free at Adobe.com