Skip to Content

Zinc Finger, AN1-type Domain 6

Antibody: CPTC-ZFAND6-1

Background

Catalog Number:
CPTC-ZFAND6-1
Target Antigen:
Zinc Finger, AN1-type Domain 6
Isotype:
IgG1
Species:
Mouse
Last Updated:
05/22/2014
Antigen Recognition(s):
recombinant full-length

Purchase

Characterization Data [Compare Characterization Data]

Western Blot

Click to enlarge image Western Blot using CPTC-ZFAND6-1 as primary Ab against ZFAND6 (rAg 00014) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).
Click to enlarge

CPTC-ZFAND6-1 Western blot

Western Blot using CPTC-ZFAND6-1 as primary Ab against ZFAND6 (rAg 00014) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).

Indirect ELISA

Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding.
Click to enlarge

CPTC-ZFAND6-1 Indirect ELISA

Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding.

NCI 60 Protein Array

CPTC-ZFAND6-1 NCI 60 Protein Array

This antibody is not suitable for use in a Reverse Phase Protein Array format as described in SOP M-105.

Antibody: CPTC-ZFAND6-2

Background

Catalog Number:
CPTC-ZFAND6-2
Target Antigen:
Zinc Finger, AN1-type Domain 6
Isotype:
IgG2a
Species:
Mouse
Last Updated:
05/22/2014
Antigen Recognition(s):
recombinant full-length

Purchase

Characterization Data [Compare Characterization Data]

Western Blot

Click to enlarge image Western Blot using CPTC-ZFAND6-2 as primary Ab against ZFAND6 (rAg 00014) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).
Click to enlarge

CPTC-ZFAND6-2 Western blot

Western Blot using CPTC-ZFAND6-2 as primary Ab against ZFAND6 (rAg 00014) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).

Indirect ELISA

Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding.
Click to enlarge

CPTC-ZFAND6-2 Indirect ELISA

Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding.

NCI 60 Protein Array

CPTC-ZFAND6-2 NCI 60 Protein Array

This antibody is not suitable for use in a Reverse Phase Protein Array format as described in SOP M-105.

Antibody: CPTC-ZFAND6-3

Background

Catalog Number:
CPTC-ZFAND6-3
Target Antigen:
Zinc Finger, AN1-type Domain 6
Isotype:
IgG2a
Species:
Mouse
Last Updated:
05/22/2014
Antigen Recognition(s):
recombinant full-length

Purchase

Characterization Data [Compare Characterization Data]

Western Blot

Click to enlarge image Western Blot using CPTC-ZFAND6-3 as primary Ab against ZFAND6 (rAg 00014) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).
Click to enlarge

CPTC-ZFAND6-3 Western blot

Western Blot using CPTC-ZFAND6-3 as primary Ab against ZFAND6 (rAg 00014) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).

Indirect ELISA

Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding.
Click to enlarge

CPTC-ZFAND6-3 Indirect ELISA

Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding.

NCI 60 Protein Array

CPTC-ZFAND6-3 NCI 60 Protein Array

This antibody is not suitable for use in a Reverse Phase Protein Array format as described in SOP M-105.

Antigen: Zinc Finger, AN1-type Domain 6

Background

NCI Identification Number:
00014
Antigen Name:
Zinc Finger, AN1-type Domain 6
CPTC Name:
CPTC-ZFAND6
Keywords:
AWP1; ZA20D3; ZFAND5B; zinc finger, A20 domain containing 3; AN1-type zinc finger protein 6; protein associated with PRK1; Associated with PRK1 protein; Zinc finger A20 domain-containing protein 3
Function:
Involved in regulation of TNF-alpha induced NF-kappa-B activation and apoptosis. Involved in modulation of 'Lys-48'-linked polyubiquitination status of TRAF2 and decreases association of TRAF2 with RIPK1. Required for PTS1 target sequence-dependent protein import into peroxisomes and PEX5 stability; may cooperate with PEX6. In vitro involved in PEX5 export from the cytosol to peroxisomes.
Chromosomal Localization:
15q25.1
Expression System:
E.coli
NCBI Accession Number:
NM_019006
Swiss Prot Accession Number:
Q6FIF0
DNA Source:
Imagenes
Immunogen:
Recombinant Full Length Protein
Vector Name:
pNIC28-Bsa4
Extinction Coefficient:
Buffers:
NaP
Expressed Sequence:
MHHHHHHSSGVDLGTENLYFQSMAQETNHSQVPMLCSTGCGFYGNP
RTNGMCSVCYKEHLQRQNSSNGRISPPATSVSSLSESLPVQCTDGS
VPEAQSALDSTSSSMQPSPVSNQSLLSESVASSQLDSTSVDKAVPE
TEDVQASVSDTAQQPSEEQSKPLEKPKQKKNRCFMCRKKVGLTGFE
CRCGNVYCGVHRYSDVLNCSYNYKADAAEKIRKENPVVVGEKIQK
Native Sequence:
Calculated Isoelectric Point:
0
Molecular Weight:
24981
Last Updated:
04/18/2013

Links

Characterization Data

Gel

Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding.
Click to enlarge

CPTC-ZFAND6 PAGE

PAGE of ZFAND6 (rAg 00014) with molecular weight standards in lane 1.

SOPs

Adobe Reader™ required.

Get Adobe Reader for free at Adobe.com