Skip to Content

tyrosine 3-monooxygenase or tryptophan 5-monooxygenase activation protein, epsilon polypeptide

Antibody: CPTC-YWHAE-1

Background

Catalog Number:
CPTC-YWHAE-1
Target Antigen:
tyrosine 3-monooxygenase or tryptophan 5-monooxygenase activation protein, epsilon polypeptide
Isotype:
IgG2a
Species:
Mouse
Last Updated:
03/08/2013
Antigen Recognition(s):

Purchase

External Links

Characterization Data [Compare Characterization Data]

Western Blot

Click to enlarge image Western Blot using CPTC-YWHAE-1 as primary Ab against rYWHAE Ag (NCI-10277) in lane 2. Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).
Click to enlarge

CPTC-YWHAE-1 Western blot

Western Blot using CPTC-YWHAE-1 as primary Ab against rYWHAE Ag (NCI-10277) in lane 2. Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).

Characterization SOP Files

Indirect ELISA

Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate)
Click to enlarge

CPTC-YWHAE-1 Indirect ELISA

Indirect ELISA (ie, binding of Antibody to Antigen coated plate)

Characterization SOP Files

NCI 60 Protein Array

CPTC-YWHAE-1 NCI 60 Protein Array

This antibody is not suitable for use in a Reverse Phase Protein Array format as described in SOP M-105.

IHC NCI60

CPTC-YWHAE-1 IHC NCI60

This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.

Click to view IHC NCI60 Cell Line Array example

IHC Tissue

CPTC-YWHAE-1 IHC Tissue

This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.

IHC HPA

Download CPTC-YWHAE-1.pdf (108.2 KB)

CPTC-YWHAE-1 Evaluation by Human Protein Atlas

This PDF contains the evaluation results provided by the Human Protein Atlas (www.proteinatlas.org)

Antibody: CPTC-YWHAE-2

Background

Catalog Number:
CPTC-YWHAE-2
Target Antigen:
tyrosine 3-monooxygenase or tryptophan 5-monooxygenase activation protein, epsilon polypeptide
Isotype:
IgG2a
Species:
Mouse
Last Updated:
03/08/2013
Antigen Recognition(s):

Purchase

Characterization Data [Compare Characterization Data]

Western Blot

Click to enlarge image Western Blot using CPTC-YWHAE-2 as primary Ab against rYWHAE Ag (NCI-10277) in lane 2. Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).
Click to enlarge

CPTC-YWHAE-2 Western blot

Western Blot using CPTC-YWHAE-2 as primary Ab against rYWHAE Ag (NCI-10277) in lane 2. Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).

Characterization SOP Files

Indirect ELISA

Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate)
Click to enlarge

CPTC-YWHAE-2 Indirect ELISA

Indirect ELISA (ie, binding of Antibody to Antigen coated plate)

Characterization SOP Files

NCI 60 Protein Array

CPTC-YWHAE-2 Protein Array

This antibody is not suitable for use in a Reverse Phase Protein Array format as described in SOP M-105.

IHC NCI60

CPTC-YWHAE-2 IHC NCI60

This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.

Click to view IHC NCI60 Cell Line Array example

IHC Tissue

CPTC-YWHAE-2 IHC Tissue

This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.

IHC HPA

Download CPTC-YWHAE-2.pdf (95.7 KB)

CPTC-YWHAE-2 Evaluation by Human Protein Atlas

This PDF contains the evaluation results provided by the Human Protein Atlas (www.proteinatlas.org)

Antibody: CPTC-YWHAE-3

Background

Catalog Number:
CPTC-YWHAE-3
Target Antigen:
tyrosine 3-monooxygenase or tryptophan 5-monooxygenase activation protein, epsilon polypeptide
Isotype:
IgG2b
Species:
Mouse
Last Updated:
03/11/2013
Antigen Recognition(s):

Purchase

Characterization Data [Compare Characterization Data]

Western Blot

Click to enlarge image Western Blot using CPTC-YWHAE-3 as primary Ab against rYWHAE Ag (NCI-10277) in lane 2. Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).
Click to enlarge

CPTC-YWHAE-3 Western blot

Western Blot using CPTC-YWHAE-3 as primary Ab against rYWHAE Ag (NCI-10277) in lane 2. Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).

Indirect ELISA

Click to enlarge image Indirect ELISA (i.e., binding of Antibody to Antigen coated plate)
Click to enlarge

CPTC-YWHAE-3 Indirect ELISA

Indirect ELISA (i.e., binding of Antibody to Antigen coated plate)

NCI 60 Protein Array

Click to enlarge image Protein Array in which CPTC-YWHAE-3 is screened against the NCI60 cell line panel for expression. Data is normalized to a mean signal of 1.0 and standard deviation of 0.5. Color conveys over-expression level (green), basal level (blue), under-expression level (red).
Click to enlarge

CPTC-YWHAE-3 Protein Array

Protein Array in which CPTC-YWHAE-3 is screened against the NCI60 cell line panel for expression. Data is normalized to a mean signal of 1.0 and standard deviation of 0.5. Color conveys over-expression level (green), basal level (blue), under-expression level (red).

IHC HPA

Download CPTC-YWHAE-3.pdf (97.8 KB)

CPTC-YWHAE-3 Evaluation by Human Protein Atlas

This PDF contains the evaluation results provided by the Human Protein Atlas (www.proteinatlas.org)

Antigen: tyrosine 3-monooxygenase or tryptophan 5-monooxygenase activation protein, epsilon polypeptide

Background

NCI Identification Number:
10277
Antigen Name:
tyrosine 3-monooxygenase or tryptophan 5-monooxygenase activation protein, epsilon polypeptide
CPTC Name:
CPTC-YWHAE
Keywords:
YWHAE; 14-3-3E; FLJ45465; KCIP-1; MDCR; MDS
Function:
This gene product belongs to the 14-3-3 family of proteins which mediate signal transduction by binding to phosphoserine-containing proteins. This highly conserved protein family is found in both plants and mammals, and this protein is 100% identical to the mouse ortholog. It interacts with CDC25 phosphatases, RAF1 and IRS1 proteins, suggesting its role in diverse biochemical activities related to signal transduction, such as cell division and regulation of insulin sensitivity. It has also been implicated in the pathogenesis of small cell lung cancer.

Adapter protein implicated in the regulation of a large spectrum of both general and specialized signaling pathway. Binds to a large number of partners, usually by recognition of a phosphoserine or phosphothreonine motif. Binding generally results in the modulation of the activity of the binding partner
Chromosomal Localization:
17p13
Expression System:
E. Coli
NCBI Accession Number:
BC001440
Swiss Prot Accession Number:
P62258
DNA Source:
HIP : HsCD00002800
Immunogen:
Recombinant Full Length Protein
Vector Name:
pMCSG7
Extinction Coefficient:
28943
Buffers:
50mM NH4HC03
Expressed Sequence:
SNAMDDREDLVYQAKLAEQAERYDEMVESMKKVAGMDVELTVEERNLLSVAY
KNVIGARRASWRIISSIEQKEENKGGEDKLKMIREYRQMVETELKLICCDIL
DVLDKHLIPAANTGESKVFYYKMKGDYHRYLAEFATGNDRKEAAENSLVAYK
AASDIAMTELPPTHPIRLGLALNFSVFYYEILNSPDRACRLAKAAFDDAIAE
LDTLSEESYKDSTLIMQLLRDNLTLWTSDMQGDGEEQNKEALQDVEDENQ
Native Sequence:
MDDREDLVYQAKLAEQAERYDEMVESMKKVAGMDVELTVEERNLLSVAYKN
VIGARRASWRIISSIEQKEENKGGEDKLKMIREYRQMVETELKLICCDILD
VLDKHLIPAANTGESKVFYYKMKGDYHRYLAEFATGNDRKEAAENSLVAYK
AASDIAMTELPPTHPIRLGLALNFSVFYYEILNSPDRACRLAKAAFDDAIA
ELDTLSEESYKDSTLIMQLLRDNLTLWTSDMQGDGEEQNKEALQDVEDENQ
Calculated Isoelectric Point:
4.63
Molecular Weight:
29446
Last Updated:
11/14/2012

Links

Characterization Data

Gel

Click to enlarge image Protein Array in which CPTC-YWHAE-3 is screened against the NCI60 cell line panel for expression. Data is normalized to a mean signal of 1.0 and standard deviation of 0.5. Color conveys over-expression level (green), basal level (blue), under-expression level (red).
Click to enlarge

Ag 10277

PAGE of Ag 10277 (with molecular weight standards in lane 1)

SOPs

Adobe Reader™ required.

Get Adobe Reader for free at Adobe.com