Skip to Content

ubiquitin-conjugating enzyme E2, J1

Antibody: CPTC-UBE2J1-1

Background

Catalog Number:
CPTC-UBE2J1-1
Target Antigen:
ubiquitin-conjugating enzyme E2, J1
Isotype:
IgG2b
Species:
Mouse
Last Updated:
02/11/2014
Antigen Recognition(s):
recombinant full-length

Purchase

Characterization Data [Compare Characterization Data]

Western Blot

Click to enlarge image Western Blot using CPTC-UBE2J1-1 as primary Ab against UBE2J1 (rAg 00013) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).
Click to enlarge

CPTC-UBE2J1-1 Western blot

Western Blot using CPTC-UBE2J1-1 as primary Ab against UBE2J1 (rAg 00013) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).

Indirect ELISA

Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding.
Click to enlarge

CPTC-UBE2J1-1 Indirect ELISA

Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding.

Antibody: CPTC-UBE2J1-2

Background

Catalog Number:
CPTC-UBE2J1-2
Target Antigen:
ubiquitin-conjugating enzyme E2, J1
Isotype:
IgG2b
Species:
Mouse
Last Updated:
02/11/2014
Antigen Recognition(s):
recombinant full-length

Purchase

Characterization Data [Compare Characterization Data]

Western Blot

Click to enlarge image Western Blot using CPTC-UBE2J1-2 as primary Ab against UBE2J1 (rAg 00013) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).
Click to enlarge

CPTC-UBE2J1-2 Western blot

Western Blot using CPTC-UBE2J1-2 as primary Ab against UBE2J1 (rAg 00013) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).

Indirect ELISA

Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding.
Click to enlarge

CPTC-UBE2J1-2 Indirect ELISA

Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding.

Antibody: CPTC-UBE2J1-3

Background

Catalog Number:
CPTC-UBE2J1-3
Target Antigen:
ubiquitin-conjugating enzyme E2, J1
Isotype:
IgG2b
Species:
Mouse
Last Updated:
02/11/2014
Antigen Recognition(s):
recombinant full-length

Purchase

Characterization Data [Compare Characterization Data]

Western Blot

Click to enlarge image Western Blot using CPTC-UBE2J1-3 as primary Ab against UBE2J1 (rAg 00013) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).
Click to enlarge

CPTC-UBE2J1-3 Western blot

Western Blot using CPTC-UBE2J1-3 as primary Ab against UBE2J1 (rAg 00013) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).

Indirect ELISA

Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding.
Click to enlarge

CPTC-UBE2J1-3 Indirect ELISA

Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding.

Antigen: ubiquitin-conjugating enzyme E2, J1

Background

NCI Identification Number:
00013
Antigen Name:
ubiquitin-conjugating enzyme E2, J1
CPTC Name:
CPTC-UBE2J1
Keywords:
NCUBE1; HSPC153; UBC6; Non-canonical ubiquitin-conjugating enzyme 1; Yeast ubiquitin-conjugating enzyme UBC6 homolog E; NCUBE-1; CGI-76; HSPC205; HSU93243; HSUBC6e; Ubc6p; ubiquitin-conjugating enzyme E2, J1, U; EC 6.3.2.19; HsUBC6e
Function:
The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. This gene encodes a member of the E2 ubiquitin-conjugating enzyme family. This enzyme is located in the membrane of the endoplasmic reticulum (ER) and may contribute to quality control ER-associated degradation by the ubiquitin-proteasome system.

Catalyzes the covalent attachment of ubiquitin to other proteins. Seems to function in the selective degradation of misfolded membrane proteins from the endoplasmic reticulum.
Chromosomal Localization:
6q15
Expression System:
E.coli
NCBI Accession Number:
NM_016021
Swiss Prot Accession Number:
Q9Y385
DNA Source:
Imagenes
Immunogen:
Recombinant Full Length Protein
Vector Name:
pNIC28-Bsa4
Extinction Coefficient:
Buffers:
NaP
Expressed Sequence:
MHHHHHHSSGVDLGTENLYFQSMSPAVKRLMKEAAE
LKDPTDHYHAQPLEDNLFEWHFTVRGPPDSDFDGGV
YHGRIVLPPEYPMKPPSIILLTANGRFEVGKKICLS
ISGHHPETWQPSWSIRTALLAIIGFMPTKGEGAIGS
LDYTPEERRALAKKSQDFCCEGCGSAMKDVLL
Native Sequence:
Calculated Isoelectric Point:
0
Molecular Weight:
19659
Last Updated:
04/18/2013

Links

Characterization Data

Gel

Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding.
Click to enlarge

CPTC-UBE2J1 PAGE

PAGE of UBE2J1 (rAg 00013) with molecular weight standards in lane 1.

SOPs

Adobe Reader™ required.

Get Adobe Reader for free at Adobe.com