Skip to Content

Ubiquitin Conjugating Enzyme E2E2

Antibody: CPTC-UBE2E2-1

Background

Catalog Number:
CPTC-UBE2E2-1
Target Antigen:
Ubiquitin Conjugating Enzyme E2E2
Isotype:
IgG2a
Species:
Mouse
Last Updated:
05/22/2014
Antigen Recognition(s):

Characterization Data [Compare Characterization Data]

Western Blot

Click to enlarge image Western Blot using CPTC-UBE2E2-1 as primary Ab against UBE2E2 (rAg 00015) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).
Click to enlarge

CPTC-UBE2E2-1 Western blot

Western Blot using CPTC-UBE2E2-1 as primary Ab against UBE2E2 (rAg 00015) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).

Indirect ELISA

Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding.
Click to enlarge

CPTC-UBE2E2-1 Indirect ELISA

Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding.

Characterization SOP Files

NCI 60 Protein Array

CPTC-UBE2E2-1 NCI 60 Protein Array

This antibody is not suitable for use in a Reverse Phase Protein Array format as described in SOP M-105.

Antibody: CPTC-UBE2E2-2

Background

Catalog Number:
CPTC-UBE2E2-2
Target Antigen:
Ubiquitin Conjugating Enzyme E2E2
Isotype:
IgG1
Species:
Mouse
Last Updated:
05/22/2014
Antigen Recognition(s):

Characterization Data [Compare Characterization Data]

Western Blot

Click to enlarge image Western Blot using CPTC-UBE2E2-2 as primary Ab against UBE2E2 (rAg 00015) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).
Click to enlarge

CPTC-UBE2E2-2 Western blot

Western Blot using CPTC-UBE2E2-2 as primary Ab against UBE2E2 (rAg 00015) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).

Indirect ELISA

Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding.
Click to enlarge

CPTC-UBE2E2-2 Indirect ELISA

Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding.

Characterization SOP Files

NCI 60 Protein Array

CPTC-UBE2E2-2 NCI 60 Protein Array

This antibody is not suitable for use in a Reverse Phase Protein Array format as described in SOP M-105.

Antibody: CPTC-UBE2E2-3

Background

Catalog Number:
CPTC-UBE2E2-3
Target Antigen:
Ubiquitin Conjugating Enzyme E2E2
Isotype:
IgG1
Species:
Mouse
Last Updated:
05/22/2014
Antigen Recognition(s):

Characterization Data [Compare Characterization Data]

Western Blot

Click to enlarge image Western Blot using CPTC-UBE2E2-3 as primary Ab against UBE2E2 (rAg 00015) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).
Click to enlarge

CPTC-UBE2E2-3 Western blot

Western Blot using CPTC-UBE2E2-3 as primary Ab against UBE2E2 (rAg 00015) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).

Indirect ELISA

Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding.
Click to enlarge

CPTC-UBE2E2-3 Indirect ELISA

Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding.

Characterization SOP Files

NCI 60 Protein Array

CPTC-UBE2E2-3 NCI 60 Protein Array

This antibody is not suitable for use in a Reverse Phase Protein Array format as described in SOP M-105.

Antigen: Ubiquitin Conjugating Enzyme E2E2

Background

NCI Identification Number:
00015
Antigen Name:
Ubiquitin Conjugating Enzyme E2E2
CPTC Name:
CPTC-UBE2E2
Keywords:
Ubiquitin-Conjugating Enzyme E2E 2; Yeast UBC4/5; Ubiquitin-Conjugating Enzyme E2E 2; UbcH8; Ubiquitin Carrier Protein E2; Ubiquitin-Protein Ligase E2; UBCH8; EC 6.3.2.19; FLJ25157;
Function:
Accepts ubiquitin from the E1 complex and catalyzes its covalent attachment to other proteins. In vitro catalyzes 'Lys-11'- and 'Lys-48'-, as well as 'Lys-63'-linked polyubiquitination.
Chromosomal Localization:
3p24.2
Expression System:
E.coli
NCBI Accession Number:
Q96LR5
Swiss Prot Accession Number:
Q96LR5
DNA Source:
Imagenes
Immunogen:
Recombinant Full Length Protein
Vector Name:
pNIC28-Bsa4
Extinction Coefficient:
Buffers:
NaP
Expressed Sequence:
MHHHHHHSSGVDLGTENLYFQSMKISSKTAAKLSTSA
KRIQKELAEITLDPPPNCSAGPKGDNIYEWRSTILGP
PGSVYEGGVFFLDITFSPDYPFKPPKVTFRTRIYHCN
INSQGVICLDILKDNWSPALTISKVLLSICSLLTDCN
PADPLVGSIATQYMTNRAEHDRMARQWTKRYAT
Native Sequence:
Calculated Isoelectric Point:
0
Molecular Weight:
20251
Last Updated:
06/10/2013

Links

Characterization Data

Gel

Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding.
Click to enlarge

CPTC-UBE2E2 PAGE

PAGE of UBE2E2 (rAg 00015) with molecular weight standards in lane 1.

SOPs

Adobe Reader™ required.

Get Adobe Reader for free at Adobe.com