Skip to Content

ubiquitin-conjugating enzyme E2E 1

Antibody: CPTC-UBE2E1 -1

Background

Catalog Number:
CPTC-UBE2E1 -1
Target Antigen:
ubiquitin-conjugating enzyme E2E 1
Isotype:
IgG1
Species:
Mouse
Last Updated:
05/22/2014
Antigen Recognition(s):

Characterization Data [Compare Characterization Data]

Western Blot

Click to enlarge image Western Blot using CPTC-UBE2E1-1 as primary Ab against UBE2E1 (rAg 00055) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).
Click to enlarge

CPTC-UBE2E1 Western blot

Western Blot using CPTC-UBE2E1-1 as primary Ab against UBE2E1 (rAg 00055) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).

Indirect ELISA

Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding.
Click to enlarge

CPTC-UBE2E1-1 Indirect ELISA

Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding.

NCI 60 Protein Array

CPTC-UBE2E1-1 NCI 60 Protein Array

This antibody is not suitable for use in a Reverse Phase Protein Array format as described in SOP M-105.

Antibody: CPTC-UBE2E1 -2

Background

Catalog Number:
CPTC-UBE2E1 -2
Target Antigen:
ubiquitin-conjugating enzyme E2E 1
Isotype:
IgG1
Species:
Mouse
Last Updated:
05/22/2014
Antigen Recognition(s):

Characterization Data [Compare Characterization Data]

Western Blot

Click to enlarge image Western Blot using CPTC-UBE2E1-2 as primary Ab against UBE2E1-2 (rAg 00055) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).
Click to enlarge

CPTC-UBE2E1-2 Western blot

Western Blot using CPTC-UBE2E1-2 as primary Ab against UBE2E1-2 (rAg 00055) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).

Indirect ELISA

Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding.
Click to enlarge

CPTC-UBE2E1-2 Indirect ELISA

Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding.

NCI 60 Protein Array

CPTC-UBE2E1-2 NCI 60 Protein Array

This antibody is not suitable for use in a Reverse Phase Protein Array format as described in SOP M-105.

Antibody: CPTC-UBE2E1 -3

Background

Catalog Number:
CPTC-UBE2E1 -3
Target Antigen:
ubiquitin-conjugating enzyme E2E 1
Isotype:
IgG1
Species:
Mouse
Last Updated:
05/22/2014
Antigen Recognition(s):

Characterization Data [Compare Characterization Data]

Western Blot

Click to enlarge image Western Blot using CPTC-UBE2E1-3 as primary Ab against UBE2E1 (rAg 00055) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).
Click to enlarge

CPTC-UBE2E1-3 Western blot

Western Blot using CPTC-UBE2E1-3 as primary Ab against UBE2E1 (rAg 00055) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).

Indirect ELISA

Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding.
Click to enlarge

CPTC-UBE2E1-3 Indirect ELISA

Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding.

NCI 60 Protein Array

CPTC-UBE2E1-3 NCI 60 Protein Array

This antibody is not suitable for use in a Reverse Phase Protein Array format as described in SOP M-105.

Antigen: ubiquitin-conjugating enzyme E2E 1

Background

NCI Identification Number:
00055
Antigen Name:
ubiquitin-conjugating enzyme E2E 1
CPTC Name:
CPTC-UBE2E1
Keywords:
Ubiquitin-Conjugating Enzyme E2E 1; Ubiquitin-Conjugating Enzyme E2E 1; UbcH6; Ubiquitin Carrier Protein E1; Ubiquitin-Protein Ligase E1; UBCH6; EC 6.3.2.19; Ubiquitin-Conjugating Enzyme E2 E1
Function:
The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. This gene encodes a member of the E2 ubiquitin-conjugating enzyme family. Three alternatively spliced transcript variants encoding distinct isoforms have been found for this gene.

Accepts ubiquitin from the E1 complex and catalyzes its covalent attachment to other proteins. Catalyzes the covalent attachment of ISG15 to other proteins. Mediates the selective degradation of short-lived and abnormal proteins. In vitro also catalyzes 'Lys-48'-linked polyubiquitination.
Chromosomal Localization:
3p24.2
Expression System:
E.coli
NCBI Accession Number:
XP_005265488.1
Swiss Prot Accession Number:
P51965
DNA Source:
Imagenes
Immunogen:
Recombinant Full Length Protein
Vector Name:
pNIC28-Bsa4
Extinction Coefficient:
Buffers:
NaP
Expressed Sequence:
MHHHHHHSSGVDLGTENLYFQSMMSDDDSRASTSSSSSSSSNQQ
TEKETNTPKKKESKVSMSKNSKLLSTSAKRIQKELADITLDPPP
NCSAGPKGDNIYEWRSTILGPPGSVYEGGVFFLDITFTPEYPFK
PPKVTFRTRIYHCNINSQGVICLDILKDNWSPALTISKVLLSIC
SLLTDCNPADPLVGSIATQYMTNRAEHDRMARQWTKRYAT
Native Sequence:
Calculated Isoelectric Point:
0
Molecular Weight:
24088
Last Updated:
10/24/2013

Links

Characterization Data

Gel

Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding.
Click to enlarge

CPTC-UBE2E1 PAGE

PAGE of UBE2E1 (rAg 00055) with molecular weight standards in lane 1

SOPs

Adobe Reader™ required.

Get Adobe Reader for free at Adobe.com