Skip to Content

Ubiquitin-conjugating enzyme E2C

Antibody: CPTC-UBE2C-1

Background

Catalog Number:
CPTC-UBE2C-1
Target Antigen:
Ubiquitin-conjugating enzyme E2C
Isotype:
IgG2b
Species:
Mouse
Last Updated:
01/24/2012
Antigen Recognition(s):
recombinant full-length

Purchase

External Links

Characterization Data [Compare Characterization Data]

Western Blot

Click to enlarge image Western Blot using CPTC-UBE2C-1 as primary Ab against Ag 10213 (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).
Click to enlarge

CPTC-UBE2C-1 Western Blot

Western Blot using CPTC-UBE2C-1 as primary Ab against Ag 10213 (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).

Indirect ELISA

Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate)
Click to enlarge

CPTC-UBE2C-1 Indirect ELISA

Indirect ELISA (ie, binding of Antibody to Antigen coated plate)

NCI 60 Protein Array

Click to enlarge image Protein Array in which CPTC-UBE2C-1 is screened against the NCI60 cell line panel for expression. Data is normalized to a mean signal of 1.0 and standard deviation of 0.5.
Click to enlarge

CPTC-UBE2C-1 NCI60 Protein Array

Protein Array in which CPTC-UBE2C-1 is screened against the NCI60 cell line panel for expression. Data is normalized to a mean signal of 1.0 and standard deviation of 0.5.

IHC NCI60

Click to enlarge image Immuno-histochemistry of CPTC-UBE2C-1 for NCI60  Cell Line Array at titer 1:250
0=NEGATIVE
1=WEAK(red)
2=MODERATE(blue)
3=STRONG(green)
Click to enlarge

CPTC-UBE2C-1 IHC NCI60

Immuno-histochemistry of CPTC-UBE2C-1 for NCI60 Cell Line Array at titer 1:250
0=NEGATIVE
1=WEAK(red)
2=MODERATE(blue)
3=STRONG(green)

Click to view IHC NCI60 Cell Line Array example

IHC Tissue

Click to enlarge image Tissue Micro-Array(TMA) core of colon cancer showing cytoplasmic staining using Antibody CPTC-UBE2C-1. Titer: 1:250
Click to enlarge

CPTC-UBE2C-1 IHC Tissue

Tissue Micro-Array(TMA) core of colon cancer showing cytoplasmic staining using Antibody CPTC-UBE2C-1. Titer: 1:250

Antigen: Ubiquitin-conjugating enzyme E2C

Background

NCI Identification Number:
10213
Antigen Name:
Ubiquitin-conjugating enzyme E2C
CPTC Name:
CPTC-UBE2C
Keywords:
UBE2C; EC 6.3.2.19; UBCH10; dJ447F3.2; OTTHUMP00000031653; OTTHUMP00000031655;
Function:
The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. This gene encodes a member of the E2 ubiquitin-conjugating enzyme family. This enzyme is required for the destruction of mitotic cyclins and for cell cycle progression. Multiple alternatively spliced transcript variants have been found for this gene, but the full-length nature of some variants has not been defined.
Chromosomal Localization:
20q13.12
Expression System:
E. Coli
NCBI Accession Number:
NM_007019
Swiss Prot Accession Number:
O00762
DNA Source:
HIP:HsCD00001519
Immunogen:
Recombinant Full Length Protein
Vector Name:
pMCSG7
Extinction Coefficient:
28483
Buffers:
50mM NH4HC03
Expressed Sequence:
SNAMASQNRDPAATSVAAARKGAEPSGGAARGPVGKR
LQQELMTLMMSGDKGISAFPESDNLFKWVGTIHGAAG
TVYEDLRYKLSLEFPSGYPYNAPTVKFLTPCYHPNVD
TQGNICLDILKEKWSALYDVRTILLSIQSLLGEPNID
SPLNTHAAELWKNPTAFKKYLQETYSKQVTSQEP
Native Sequence:
ASQNRDPAATSVAAARKGAEPSGGAARGPVGKRLQQ
ELMTLMMSGDKGISAFPESDNLFKWVGTIHGAAGTV
YEDLRYKLSLEFPSGYPYNAPTVKFLTPCYHPNVDT
QGNICLDILKEKWSALYDVRTILLSIQSLLGEPNID
SPLNTHAAELWKNPTAFKKYLQETYSKQVTSQEP
Calculated Isoelectric Point:
6.8
Molecular Weight:
19925
Last Updated:
11/14/2012

Links

Characterization Data

Gel

Click to enlarge image Tissue Micro-Array(TMA) core of colon cancer showing cytoplasmic staining using Antibody CPTC-UBE2C-1. Titer: 1:250
Click to enlarge

Ag 10213

PAGE of Ag 10213 (with molecular weight standards in lane 1)

SOPs

Adobe Reader™ required.

Get Adobe Reader for free at Adobe.com