Skip to Content

Ubiquitin-like modifier activating enzyme 1

Antibody: CPTC-UBA1-1

Background

Catalog Number:
CPTC-UBA1-1
Target Antigen:
Ubiquitin-like modifier activating enzyme 1
Isotype:
IgG2b
Species:
Mouse
Last Updated:
05/22/2014
Antigen Recognition(s):

Purchase

Characterization Data [Compare Characterization Data]

Western Blot

Click to enlarge image Western Blot using CPTC-UBA1-1 as primary Ab against UB2L6 (rAg 00057) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).
Click to enlarge

CPTC-UBA1-1 Western blot

Western Blot using CPTC-UBA1-1 as primary Ab against UB2L6 (rAg 00057) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).

Characterization SOP Files

Indirect ELISA

Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding.
Click to enlarge

CPTC-UBA1-1 Indirect ELISA

Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding.

Characterization SOP Files

NCI 60 Protein Array

CPTC-UBA1-1 NCI 60 Protein Array

This antibody is not suitable for use in a Reverse Phase Protein Array format as described in SOP M-105.

Antibody: CPTC-UBA1-2

Background

Catalog Number:
CPTC-UBA1-2
Target Antigen:
Ubiquitin-like modifier activating enzyme 1
Isotype:
IgG2b
Species:
Mouse
Last Updated:
05/22/2014
Antigen Recognition(s):

Purchase

Characterization Data [Compare Characterization Data]

Western Blot

Click to enlarge image Western Blot using CPTC-UBA1-2 as primary Ab against UB2L6 (rAg 00057) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).
Click to enlarge

CPTC-UBA1-2 Western blot

Western Blot using CPTC-UBA1-2 as primary Ab against UB2L6 (rAg 00057) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).

Characterization SOP Files

Indirect ELISA

Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding.
Click to enlarge

CPTC-UBA1-2 Indirect ELISA

Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding.

Characterization SOP Files

NCI 60 Protein Array

CPTC-UBA1-2 NCI 60 Protein Array

This antibody is not suitable for use in a Reverse Phase Protein Array format as described in SOP M-105.

Antibody: CPTC-UBA1-3

Background

Catalog Number:
CPTC-UBA1-3
Target Antigen:
Ubiquitin-like modifier activating enzyme 1
Isotype:
IgG1
Species:
Mouse
Last Updated:
05/22/2014
Antigen Recognition(s):

Purchase

Characterization Data [Compare Characterization Data]

Western Blot

Click to enlarge image Western Blot using CPTC-UBA1-3 as primary Ab against UB2L6 (rAg 00057) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).
Click to enlarge

CPTC-UBA1-3 Western blot

Western Blot using CPTC-UBA1-3 as primary Ab against UB2L6 (rAg 00057) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).

Characterization SOP Files

Indirect ELISA

Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding.
Click to enlarge

CPTC-UBA1-3 Indirect ELISA

Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding.

Characterization SOP Files

NCI 60 Protein Array

CPTC-UBA1-3 NCI 60 Protein Array

This antibody is not suitable for use in a Reverse Phase Protein Array format as described in SOP M-105.

Antigen: Ubiquitin-like modifier activating enzyme 1

Background

NCI Identification Number:
00057
Antigen Name:
Ubiquitin-like modifier activating enzyme 1
CPTC Name:
CPTC-UBA1
Keywords:
UBE1; A1S9T; GXP1; POC20; UBE1X; Ubiquitin-Activating Enzyme E1; A1ST; AMCX1; SMAX2; Ubiquitin-Activating Enzyme E1; A1S9; UBA1A; A1S9T And BN75 Temperature Sensitivity Complementing; POC20 Centriolar Protein Homolog; UBA1, Ubiquitin-Activating Enzyme E1 Homolog A; Ubiquitin-Like Modifier-Activating Enzyme 1; Protein A1S9
Function:
The protein encoded by this gene catalyzes the first step in ubiquitin conjugation to mark cellular proteins for degradation. This gene complements an X-linked mouse temperature-sensitive defect in DNA synthesis, and thus may function in DNA repair. It is part of a gene cluster on chromosome Xp11.23. Alternatively spliced transcript variants that encode the same protein have been described.

Activates ubiquitin by first adenylating its C-terminal glycine residue with ATP, and thereafter linking this residue to the side chain of a cysteine residue in E1, yielding an ubiquitin-E1 thioester and free AMP.
Chromosomal Localization:
XP11.23
Expression System:
E. coli
NCBI Accession Number:
NP_695012.1
Swiss Prot Accession Number:
P22314
DNA Source:
mammalian Gene Collection
Immunogen:
Recombinant Full Length Protein
Vector Name:
pET 28-MHL
Extinction Coefficient:
Buffers:
PBS pH 7.4
Expressed Sequence:
mhhhhhhssgrenlyfqgGSEADIDEGLYSRQLYVLGHEAMKRLQTSSVLVSGLRGLGVEIAKNIILGGVKAVTLHDQG
TAQWADLSSQFYLREEDIGKNRAEVSQPRLAELNSYVPVTAYTGPLVEDFLSGFQVVVLTNTPLEDQLRVGEFCHNRGI
KLVVADTRGLFGQLFCDFGEEMILTDSNGEQPLSAMVSMVTKDNPGVVTCLDEARHGFESGDFVSFSEVQGMVELNGNQ
PMEIKVLGPYTFSICDTSNFSDYIRGGIVSQVKVPKKISFKSLVASLAEPDFVVTDFAKFSRPAQLHIGFQALHQFCAQ
HGRPPRPRNEEDAAELVALAQAVNARALPAVQQNNLDEDLIRKLAYVAAGDLAPINAFIGGLAAQEVMKACSGKFMPIM
QWLYFDALECLPEDKEVLTEDKCLQRQNRYDGQVAVFGSDLQEKLGKQKYFLVGAGAIGCELLKNFAMIGLGCGEGGEI
IVTDMDTIEKSNLNRQFLFRPWDVTKLKSDTAAAAVRQMNPHIRVTSHQNRVGPDTERIYDDDFFQNLDGVANALDNVD
ARMYMDRRCVYYRKPLLESGTLGTKGNVQVVIPFLTESYSSSQDPPEKSIPICTLKNFPNAIEHTLQWARDEFEGLFKQ
PAENVNQYLTDPKFVERTLRLAGTQPLEVLEAVQRSLVLQRPQTWADCVTWACHHWHTQYSNNIRQLLHNFPPDQLTSS
GAPFWSGPKRCPHPLTFDVNNPLHLDYVMAAANLFAQTYGLTGSQDRAAVATFLQSVQVPEFTPKSGVKIHVSDQELQS
ANASVDDSRLEELKATLPSPDKLPGFKMYPIDFEKDDDSNFHMDFIVAASNLRAENYDIPSADRHKSKLIAG
Native Sequence:
Calculated Isoelectric Point:
5.2
Molecular Weight:
95916
Last Updated:
10/24/2013

Links

Characterization Data

Gel

Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding.
Click to enlarge

CPTC-UBA1 PAGE

PAGE of UBA1 (rAg 00057) with molecular weight standards in lane 1

SOPs

Adobe Reader™ required.

Get Adobe Reader for free at Adobe.com