Skip to Content

Ubiquitin Conjugating Enzyme E2L 6

Antibody: CPTC-UB2L6-1

Background

Catalog Number:
CPTC-UB2L6-1
Target Antigen:
Ubiquitin Conjugating Enzyme E2L 6
Isotype:
IgG2b
Species:
Mouse
Last Updated:
07/18/2013
Antigen Recognition(s):

Characterization Data [Compare Characterization Data]

Western Blot

Click to enlarge image Western Blot using CPTC-UB2L6-1 as primary Ab against UB2L6 (rAg 00012) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).
Click to enlarge

CPTC-UB2L6-1 Western blot

Western Blot using CPTC-UB2L6-1 as primary Ab against UB2L6 (rAg 00012) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).

Indirect ELISA

Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding.
Click to enlarge

CPTC-UB2L6-1 Indirect ELISA

Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding.

Characterization SOP Files

Antibody: CPTC-UB2L6-2

Background

Catalog Number:
CPTC-UB2L6-2
Target Antigen:
Ubiquitin Conjugating Enzyme E2L 6
Isotype:
IgG1
Species:
Mouse
Last Updated:
07/18/2013
Antigen Recognition(s):

Characterization Data [Compare Characterization Data]

Western Blot

Click to enlarge image Western Blot using CPTC-UB2L6-2 as primary Ab against UB2L6 (rAg 00012) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).
Click to enlarge

CPTC-UB2L6-2 Western blot

Western Blot using CPTC-UB2L6-2 as primary Ab against UB2L6 (rAg 00012) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).

Indirect ELISA

Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding.
Click to enlarge

CPTC-UB2L6-2 Indirect ELISA

Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding.

Characterization SOP Files

Antibody: CPTC-UB2L6-3

Background

Catalog Number:
CPTC-UB2L6-3
Target Antigen:
Ubiquitin Conjugating Enzyme E2L 6
Isotype:
IgG1
Species:
Mouse
Last Updated:
07/18/2013
Antigen Recognition(s):

Characterization Data [Compare Characterization Data]

Western Blot

Click to enlarge image Western Blot using CPTC-UB2L6-3 as primary Ab against UB2L6 (rAg 00012) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).
Click to enlarge

CPTC-UB2L6-3 Western blot

Western Blot using CPTC-UB2L6-3 as primary Ab against UB2L6 (rAg 00012) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).

Characterization SOP Files

Indirect ELISA

Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding.
Click to enlarge

CPTC-UB2L6-3 Indirect ELISA

Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding.

Characterization SOP Files

Antigen: Ubiquitin Conjugating Enzyme E2L 6

Background

NCI Identification Number:
00012
Antigen Name:
Ubiquitin Conjugating Enzyme E2L 6
CPTC Name:
CPTC-UB2L6
Keywords:
ubiquitin-conjugating enzyme E2L 6; UBCH8; Retinoic acid-induced gene B protein; Ubiquitin carrier protein L6; Ubiquitin-protein ligase L6; RIG-B; EC 6.3.2.19; retinoic acid induced gene B protein; ubiquitin/ISG15-conjugating enzyme E2 L6; UbcH8
Function:
The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes (E1s), ubiquitin-conjugating enzymes (E2s) and ubiquitin-protein ligases (E3s). This gene encodes a member of the E2 ubiquitin-conjugating enzyme family. This enzyme is highly similar in primary structure to the enzyme encoded by the UBE2L3 gene. Two alternatively spliced transcript variants encoding distinct isoforms have been found for this gene.

Catalyzes the covalent attachment of ubiquitin or ISG15 to other proteins. Functions in the E6/E6-AP-induced ubiquitination of p53/TP53. Promotes ubiquitination and subsequent proteasomal degradation of FLT3.
Chromosomal Localization:
11q12.1
Expression System:
E.coli
NCBI Accession Number:
NP_004214
Swiss Prot Accession Number:
O14933
DNA Source:
Imagenes
Immunogen:
Recombinant Full Length Protein
Vector Name:
pNIC28-Bsa4
Extinction Coefficient:
Buffers:
NaP
Expressed Sequence:
MHHHHHHSSGVDLGTENLYFQSMASMRVVKELEDL
QKKPPPYLRNLSSDDANVLVWHALLLPDQPPYHLK
AFNLRISFPPEYPFKPPMIKFTTKIYHPNVDENGQ
ICLPIISSENWKPCTKTCQVLEALNVLVNRPNIRE
PLRMDLADLLTQNPELFRKNAEEFTLRFGVDRPS
Native Sequence:
Calculated Isoelectric Point:
0
Molecular Weight:
20190
Last Updated:
04/17/2013

Links

Characterization Data

Gel

Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding.
Click to enlarge

CPTC-UB2L6 PAGE

PAGE of rAg 00012 (with molecular weight standards in lane 1)

SOPs

Adobe Reader™ required.

Get Adobe Reader for free at Adobe.com