Skip to Content

Topoisomerase I Mitochondrial

Antibody: CPTC-TOP1MT-1

Background

Catalog Number:
CPTC-TOP1MT-1
Target Antigen:
Topoisomerase I Mitochondrial
Isotype:
IgG2b
Species:
Mouse
Last Updated:
11/26/2013
Antigen Recognition(s):
recombinant full-length

Purchase

Characterization Data [Compare Characterization Data]

Western Blot

Click to enlarge image Western Blot using CPTC-TOP1MT-1 as primary Ab against recombinant topoisomerase1 MT (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).
Click to enlarge

CPTC-TOP1-1 Western blot

Western Blot using CPTC-TOP1MT-1 as primary Ab against recombinant topoisomerase1 MT (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).

Indirect ELISA

Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding.
Click to enlarge

CPTC-TOP1MT-1 Indirect ELISA

Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding.

NCI 60 Protein Array

CPTC-TOP1-1 Protein Array

This antibody is not suitable for use in a Reverse Phase Protein Array format as described in SOP M-105.

Antibody: CPTC-TOP1MT-2

Background

Catalog Number:
CPTC-TOP1MT-2
Target Antigen:
Topoisomerase I Mitochondrial
Isotype:
IgG1
Species:
Mouse
Last Updated:
11/26/2013
Antigen Recognition(s):
recombinant full-length

Purchase

Characterization Data [Compare Characterization Data]

Western Blot

Click to enlarge image Western Blot using CPTC-TOP1MT-2 as primary Ab against recombinant topoisomerase1 MT (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).
Click to enlarge

CPTC-TOP1MT-2 Western blot

Western Blot using CPTC-TOP1MT-2 as primary Ab against recombinant topoisomerase1 MT (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).

Indirect ELISA

Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding.
Click to enlarge

CPTC-TOP1MT-2 Indirect ELISA

Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding.

NCI 60 Protein Array

CPTC-TOP1-2 Protein Array

This antibody is not suitable for use in a Reverse Phase Protein Array format as described in SOP M-105.

Antibody: CPTC-TOP1MT-3

Background

Catalog Number:
CPTC-TOP1MT-3
Target Antigen:
Topoisomerase I Mitochondrial
Isotype:
IgG2b
Species:
Mouse
Last Updated:
11/26/2013
Antigen Recognition(s):
recombinant full-length

Purchase

Characterization Data [Compare Characterization Data]

Western Blot

Click to enlarge image Western Blot using CPTC-TOP1-3 as primary Ab against recombinant topoisomerase1 MT (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).
Click to enlarge

CPTC-TOP1MT-3 Western blot

Western Blot using CPTC-TOP1-3 as primary Ab against recombinant topoisomerase1 MT (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).

Indirect ELISA

Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding.
Click to enlarge

CPTC-TOP1MT-3 Indirect ELISA

Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding.

NCI 60 Protein Array

CPTC-TOP1-3 Protein Array

This antibody is not suitable for use in a Reverse Phase Protein Array format as described in SOP M-105.

Antigen: Topoisomerase I Mitochondrial

Background

NCI Identification Number:
00001
Antigen Name:
Topoisomerase I Mitochondrial
CPTC Name:
CPTC-TOP1MT
Keywords:
topoisomerase (DNA) I, mitochondrial; EC 5.99.1.2; mitochondrial DNA topoisomerase 1; TOP1mt;
Function:
Releases the supercoiling and torsional tension of DNA introduced during duplication of mitochondrial DNA by
transiently cleaving and rejoining one strand of the DNA duplex. Introduces a single-strand break via transesterification at a target site in duplex DNA. The scissile phosphodiester is attacked by the catalytic tyrosine
of the enzyme, resulting in the formation of a DNA-(3'-phosphotyrosyl)-enzyme intermediate and the expulsion of a 5'-OH DNA strand. The free DNA strand than undergoes passage around the unbroken strand thus removing DNA supercoils. Finally, in the religation step, the DNA 5'-OH attacks the covalent intermediate to expel the active-site tyrosine and restore the DNA phosphodiester backbone
Chromosomal Localization:
8q24.3
Expression System:
E. coli
NCBI Accession Number:
NM_052963
Swiss Prot Accession Number:
Q969P6
DNA Source:
PEL:7387-X02-605
Immunogen:
Recombinant Full Length Protein
Vector Name:
pDest-605
Extinction Coefficient:
Buffers:
Expressed Sequence:
MRVVRLLRLRAALTLLGEVPRRPASRGVPGSRRTQKGSGARWEKEKHEDGVKWRQLEHKGP
YFAPPYEPLPDGVRF FYEGRPVRLSVAAEEVATFYGRMLDHEYTTKEVFRKNFFNDWRKE
MAVEEREVIKSLDKCDFTEIHRYFVDKAAAR KVLSREEKQKLKEEAEKLQQEFGYCILDG
HQEKIGNFKIEPPGLFRGRGDHPKMGMLKRRITPEDVVINCSRDSKI PEPPAGHQWKEVR
SDNTVTWLAAWTESVQNSIKYIMLNPCSKLKGETAWQKFETARRLRGFVDEIRSQYRADWK
SR EMKTRQRAVALYFIDKLALRAGNEKEDGEAADTVGCCSLRVEHVQLHPEADGCQHVVE
FDFLGKDCIRYYNRVPVE KPVYKNLQLFMENKDPRDDLFDRLTTTSLNKHLQELMDGLTA
KVFRTYNASITLQEQLRALTRAEDSIAAKILSYN RANRVVAILCNHQRATPSTFEKSMQN
LQTKIQAKKEQVAEARAELRRARAEHKAQGDGKSRSVLEKKRRLLEKLQE QLAQLSVQAT
DKEENKQVALGTSKLNYLDPRISIAWCKRFRVPVEKIYSKTQRERFAWALAMAGEDFEF
Native Sequence:
Calculated Isoelectric Point:
0
Molecular Weight:
69872
Last Updated:
11/14/2012

Links

Characterization Data

Gel

Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding.
Click to enlarge

CPTC-TOP1MT

PAGE of recombinant Topoisomerase1 MT (CPTC-TOP1MT) (with molecular weight standards in lane 1)

SOPs

Adobe Reader™ required.

Get Adobe Reader for free at Adobe.com