Skip to Content

Tyrosyl-DNA Phosphodiesterase 2

Antibody: CPTC-TDP2-1

Background

Catalog Number:
CPTC-TDP2-1
Target Antigen:
Tyrosyl-DNA Phosphodiesterase 2
Isotype:
IgG1
Species:
Mouse
Last Updated:
06/12/2014
Antigen Recognition(s):

Characterization Data [Compare Characterization Data]

Western Blot

Click to enlarge image Western Blot using CPTC-TDP2-1 as primary Ab against TDP2 (rAg 00005) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).
Click to enlarge

CPTC-TDP2-1 Western blot

Western Blot using CPTC-TDP2-1 as primary Ab against TDP2 (rAg 00005) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).

Indirect ELISA

Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding.
Click to enlarge

CPTC-TDP2-1 Indirect ELISA

Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding.

NCI 60 Protein Array

CPTC-TDP2-1 NCI 60 Protein Array

This antibody is not suitable for use in a Reverse Phase Protein Array format as described in SOP M-105.

Antibody: CPTC-TDP2-2

Background

Catalog Number:
CPTC-TDP2-2
Target Antigen:
Tyrosyl-DNA Phosphodiesterase 2
Isotype:
IgG2a
Species:
Mouse
Last Updated:
06/12/2014
Antigen Recognition(s):

Characterization Data [Compare Characterization Data]

Western Blot

Click to enlarge image Western Blot using CPTC-TDP2-2 as primary Ab against TDP2 (rAg 00005) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).
Click to enlarge

CPTC-TDP2-2 Western blot

Western Blot using CPTC-TDP2-2 as primary Ab against TDP2 (rAg 00005) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).

Indirect ELISA

Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding.
Click to enlarge

CPTC-TDP2-2 Indirect ELISA

Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding.

NCI 60 Protein Array

CPTC-TDP2-2 NCI 60 Protein Array

This antibody is not suitable for use in a Reverse Phase Protein Array format as described in SOP M-105.

Antibody: CPTC-TDP2-3

Background

Catalog Number:
CPTC-TDP2-3
Target Antigen:
Tyrosyl-DNA Phosphodiesterase 2
Isotype:
IgG1
Species:
Mouse
Last Updated:
06/12/2014
Antigen Recognition(s):

Characterization Data [Compare Characterization Data]

Western Blot

Click to enlarge image Western Blot using CPTC-TDP2-3 as primary Ab against TDP2 (rAg 00005) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).
Click to enlarge

CPTC-TDP2-3 Western blot

Western Blot using CPTC-TDP2-3 as primary Ab against TDP2 (rAg 00005) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).

Indirect ELISA

Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding.
Click to enlarge

CPTC-TDP2-3 Indirect ELISA

Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding.

NCI 60 Protein Array

CPTC-TDP2-3 NCI 60 Protein Array

This antibody is not suitable for use in a Reverse Phase Protein Array format as described in SOP M-105.

Antigen: Tyrosyl-DNA Phosphodiesterase 2

Background

NCI Identification Number:
00005
Antigen Name:
Tyrosyl-DNA Phosphodiesterase 2
CPTC Name:
CPTC-TDP2
Keywords:
tyrosyl-DNA phosphodiesterase 2; EAPII; TTRAP; ETS1-associated protein 2;TRAF and TNF receptor associated protein; ETS1-associated protein II; Tyr-DNA phosphodiesterase 2; TRAF and TNF receptor-associated protein; 5'-Tyr-DNA phosphodiesterase; AD022; 5'-tyrosyl-DNA phosphodiesterase; dJ30M3.3; EAP2; EC 3.1.4
Function:
This gene encodes a member of a superfamily of divalent cation-dependent phosphodiesterases. The encoded protein associates with CD40, tumor necrosis factor (TNF) receptor-75 and TNF receptor associated factors (TRAFs), and inhibits nuclear factor-kappa-B activation. This protein has sequence and structural similarities with APE1 endonuclease, which is involved in both DNA repair and the activation of transcription factors.

DNA repair enzyme that can remove a variety of covalent adducts from DNA through hydrolysis of a 5'-phosphodiester bond, giving rise to DNA with a free 5' phosphate. Catalyzes the hydrolysis of dead-end complexes
between DNA and the topoisomerase 2 (TOP2) active site tyrosine residue. Hydrolyzes 5'-phosphoglycolates on protruding 5' ends on DNA double-strand breaks (DSBs) due to DNA damage by radiation and free radicals. The 5'-tyrosyl DNA phosphodiesterase activity can enable the repair of TOP2-induced DSBs without the need for nuclease activity, creating a 'clean' DSB with 5'-phosphate termini that are ready for ligation. Has also 3'-tyrosyl DNA phosphodiesterase activity, but less efficiently and much slower than TDP1. May also act as a negative regulator of ETS1 and may inhibit nuclear factor-kappa-B activation.

Chromosomal Localization:
6p22.3 - p22.1
Expression System:
Baculovirus
NCBI Accession Number:
NM_016614
Swiss Prot Accession Number:
O95551
DNA Source:
xxx
Immunogen:
Recombinant Full Length Protein
Vector Name:
His6-GST tev
Extinction Coefficient:
Buffers:
Expressed Sequence:
MELGSCLEGGREAAEEEGEPEVKKRRLLCVEFASVASCDAAVAQCFLAENDWEMERALNSY
FEPPVEESALERRPETISEPKTYVDLTNEETTDSTTSKISPSEDTQQENGSMFSLITWNID
GLDLNNLSERARGVCSYLALYSPDVIFLQEVIPPYYSYLKKRSSNYEIITGHEEGYFTAIM
LKKSRVKLKSQEIIPFPSTKMMRNLLCVHVNVSGNELCLMTSHLESTRGHAAERMNQLKMV
LKKMQEAPESATVIFAGDTNLRDREVTRCGGLPNNIVDVWEFLGKPKHCQYTWDTQMNSNL
GITAACKLRFDRIFFRAAAEEGHIIPRSLDLLGLEKLDCGRFPSDHWGLLCNLDIIL
Native Sequence:
Calculated Isoelectric Point:
0
Molecular Weight:
40927
Last Updated:
11/28/2012

Links

Characterization Data

Gel

Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding.
Click to enlarge

CPTC-TDPS PAGE

PAGE of TDP2 (Ag 00005) with molecular weight standards in lane 1

SOPs

Adobe Reader™ required.

Get Adobe Reader for free at Adobe.com