Skip to Content

Tumor-associated Calcium Signal Transducer 2

Antibody: CPTC-TACSTD2-1

Background

Catalog Number:
CPTC-TACSTD2-1
Target Antigen:
Tumor-associated Calcium Signal Transducer 2
Isotype:
IgG1
Species:
Mouse
Last Updated:
04/16/2013
Antigen Recognition(s):

Characterization Data [Compare Characterization Data]

Western Blot

Click to enlarge image Western Blot using CPTC-TACSTD2-1 as primary Ab against TDP2 (rAg 00007) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).
Click to enlarge

CPTC-TACSTD2-1 Western blot

Western Blot using CPTC-TACSTD2-1 as primary Ab against TDP2 (rAg 00007) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).

Indirect ELISA

Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding.
Click to enlarge

CPTC-TACSTD2-1 Indirect ELISA

Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding.

Characterization SOP Files

SPR

Download TACSTD2 pairing.pdf (792.7 KB)

CPTC-TACSTD2-1 Pairing Data

This table shows the data for pairing of the three CPTC-TACSTD2 antibodies.

Antibody: CPTC-TACSTD2-2

Background

Catalog Number:
CPTC-TACSTD2-2
Target Antigen:
Tumor-associated Calcium Signal Transducer 2
Isotype:
IgG1
Species:
Mouse
Last Updated:
04/16/2013
Antigen Recognition(s):

Characterization Data [Compare Characterization Data]

Western Blot

Click to enlarge image Western Blot using CPTC-TACSTD2-2 as primary Ab against TDP2 (rAg 00007) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).
Click to enlarge

CPTC-TACSTD2-2 Western blot

Western Blot using CPTC-TACSTD2-2 as primary Ab against TDP2 (rAg 00007) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).

Characterization SOP Files

Indirect ELISA

Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding.
Click to enlarge

CPTC-TACSTD2-2 Indirect ELISA

Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding.

Characterization SOP Files

SPR

Download TACSTD2 pairing.pdf (792.7 KB)

CPTC-TACSTD2-2 pairing data

This table shows the data for pairing of the three CPTC-TACSTD2 antibodies.

Antibody: CPTC-TACSTD2-3

Background

Catalog Number:
CPTC-TACSTD2-3
Target Antigen:
Tumor-associated Calcium Signal Transducer 2
Isotype:
IgG1
Species:
Mouse
Last Updated:
04/16/2013
Antigen Recognition(s):

Characterization Data [Compare Characterization Data]

Western Blot

Click to enlarge image Western Blot using CPTC-TACSTD2-3 as primary Ab against TDP2 (rAg 00007) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).
Click to enlarge

CPTC-TACSTD2-3 Western blot

Western Blot using CPTC-TACSTD2-3 as primary Ab against TDP2 (rAg 00007) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).

Indirect ELISA

Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding.
Click to enlarge

CPTC-TACSTD2-3 Indirect ELISA

Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding.

Characterization SOP Files

SPR

Download TACSTD2 pairing.pdf (792.7 KB)

CPTC-TACSTD2-3 pairing data

This table shows the data for pairing of the three CPTC-TACSTD2 antibodies.

Antigen: Tumor-associated Calcium Signal Transducer 2

Background

NCI Identification Number:
00007
Antigen Name:
Tumor-associated Calcium Signal Transducer 2
CPTC Name:
CPTC-TACSTD2
Keywords:
M1S1;EGP1; tumor-associated calcium signal transducer 2; GA7331; TROP2; GP50; GA733-1; cell surface glycoprotein TROP2; EGP-1; epithelial glycoprotein-1; Cell surface glycoprotein Trop-2; gastrointestinal tumor-associated antigen GA7331; Membrane component chromosome 1 surface marker 1; membrane component, chromosome 1, surface marker 1; Pancreatic carcinoma marker protein GA733-1; pancreatic carcinoma marker protein GA7331; 40kD glycoprotein, identified by monoclonal antibody GA733;
Function:
This intronless gene encodes a carcinoma-associated antigen. This antigen is a cell surface receptor that transduces calcium signals. Mutations of this gene have been associated with gelatinous drop-like corneal dystrophy. May function as a growth factor receptor.
Chromosomal Localization:
1p32
Expression System:
E. coli
NCBI Accession Number:
NM_002353
Swiss Prot Accession Number:
P09758
DNA Source:
human ORFeome 1.1 collection, clone BC009409
Immunogen:
Recombinant Domain
Vector Name:
11725-X04-008
Extinction Coefficient:
Buffers:
Expressed Sequence:
QDNCTCPTNKMTVCSPDGPGGRCQCRALGSGMAVDCSTLTSKCLLLKARM
SAPKNARTLVRPSEHALVDNDGLYDPDCDPEGRFKARQCNQTSVCWCVNS
VGVRRTDKGDLSLRCDELVRTHHILIDLRHRPTAGAFNHSDLDAELRRLF
RERYRLHPKFVAAVHYEQPTIQIELRQNTSQKAAGDVDIGDAAYYFERDI
KGESLFQGRGGLDLRVRGEPLQVERTLIYYLDEIPPKFSMKRLTHHHHHH
Native Sequence:
Calculated Isoelectric Point:
0
Molecular Weight:
28321
Last Updated:
12/03/2013

Links

Characterization Data

Gel

Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding.
Click to enlarge

CPTC-TACSTD2 PAGE

PAGE of TACSTD2 (Ag 00007) with molecular weight standards in lane 1

SOPs

Adobe Reader™ required.

Get Adobe Reader for free at Adobe.com