Skip to Content

14-3-3 sigma

Antibody: CPTC-SFN-1

Background

Catalog Number:
CPTC-SFN-1
Target Antigen:
14-3-3 sigma
Isotype:
IgG1
Species:
Mouse
Last Updated:
02/25/2013
Antigen Recognition(s):
recombinant full-length

Purchase

Characterization Data [Compare Characterization Data]

Western Blot

Click to enlarge image Western Blot using CPTC-SFN-1 as primary Ab against Ag 10467 (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).
Click to enlarge

CPTC-SFN-1 Western Blot

Western Blot using CPTC-SFN-1 as primary Ab against Ag 10467 (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).

Indirect ELISA

Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate)
Click to enlarge

CPTC-SFN-1 Indirect ELISA

Indirect ELISA (ie, binding of Antibody to Antigen coated plate)

NCI 60 Protein Array

CPTC-SFN-1 NCI 60 Protein Array

This antibody is not suitable for use in a Reverse Phase Protein Array format as described in SOP M-105.

IHC NCI60

CPTC-SFN-1 IHC NCI60

This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.

Click to view IHC NCI60 Cell Line Array example

IHC Tissue

CPTC-SFN-1 IHC Tissue

This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.

Antibody: CPTC-SFN-2

Background

Catalog Number:
CPTC-SFN-2
Target Antigen:
14-3-3 sigma
Isotype:
IgG1
Species:
Mouse
Last Updated:
01/24/2012
Antigen Recognition(s):
recombinant full-length

Purchase

External Links

Characterization Data [Compare Characterization Data]

Western Blot

Click to enlarge image Western Blot using CPTC-SFN-2 as primary Ab against Ag 10467 (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).
Click to enlarge

CPTC-SFN-2 Western Blot

Western Blot using CPTC-SFN-2 as primary Ab against Ag 10467 (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).

Indirect ELISA

Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate)
Click to enlarge

CPTC-SFN-2 Indirect ELISA

Indirect ELISA (ie, binding of Antibody to Antigen coated plate)

NCI 60 Protein Array

Click to enlarge image Protein Array in which CPTC-SFN-2 is screened against the NCI60 cell line panel for expression. Data is normalized to a mean signal of 1.0 and standard deviation of 0.5. Color conveys over-expression level (green), basal level (blue), under-expression level (red).
Click to enlarge

CPTC-SFN-2 NCI 60 Protein Array

Protein Array in which CPTC-SFN-2 is screened against the NCI60 cell line panel for expression. Data is normalized to a mean signal of 1.0 and standard deviation of 0.5. Color conveys over-expression level (green), basal level (blue), under-expression level (red).

IHC NCI60

Click to enlarge image Immuno-histochemistry of CPTC-SFN-2 for NCI60  Cell Line Array at titer 1:100
0=NEGATIVE
1=WEAK(red)
2=MODERATE(blue)
3=STRONG(green)
Click to enlarge

CPTC-SFN-2 IHC NCI60

Immuno-histochemistry of CPTC-SFN-2 for NCI60 Cell Line Array at titer 1:100
0=NEGATIVE
1=WEAK(red)
2=MODERATE(blue)
3=STRONG(green)

Click to view IHC NCI60 Cell Line Array example

IHC Tissue

Click to enlarge image Tissue Micro-Array(TMA) core of breast cancer showing cytoplasmic staining using Antibody CPTC-SFN-2 . Titer: 1:100
Click to enlarge

CPTC-SFN-2 IHC Tissue

Tissue Micro-Array(TMA) core of breast cancer showing cytoplasmic staining using Antibody CPTC-SFN-2 . Titer: 1:100

Antibody: CPTC-SFN-3

Background

Catalog Number:
CPTC-SFN-3
Target Antigen:
14-3-3 sigma
Isotype:
IgG1
Species:
Mouse
Last Updated:
03/07/2013
Antigen Recognition(s):

Purchase

Characterization Data [Compare Characterization Data]

Western Blot

Click to enlarge image Western Blot using CPTC-SFN-3 as primary Ab against Ag 10467 (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).
Click to enlarge

CPTC-SFN-3 Western Blot

Western Blot using CPTC-SFN-3 as primary Ab against Ag 10467 (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).

Indirect ELISA

Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate)
Click to enlarge

CPTC-SFN-3 Indirect ELISA

Indirect ELISA (ie, binding of Antibody to Antigen coated plate)

NCI 60 Protein Array

Click to enlarge image Protein Array in which CPTC-SFN-3 is screened against the NCI60 cell line panel for expression. Data is normalized to a mean signal of 1.0 and standard deviation of 0.5. Color conveys over-expression level (green), basal level (blue), under-expression level (red).
Click to enlarge

CPTC-SFN-3 NCI60 Protein Array

Protein Array in which CPTC-SFN-3 is screened against the NCI60 cell line panel for expression. Data is normalized to a mean signal of 1.0 and standard deviation of 0.5. Color conveys over-expression level (green), basal level (blue), under-expression level (red).

IHC NCI60

Click to enlarge image Immuno-histochemistry of CPTC-SFN-3 for NCI60  Cell Line Array at titer 1:500
0=NEGATIVE
1=WEAK
2=MODERATE
3=STRONG
Click to enlarge

CPTC-SFN-3 IHC NCI60

Immuno-histochemistry of CPTC-SFN-3 for NCI60 Cell Line Array at titer 1:500
0=NEGATIVE
1=WEAK
2=MODERATE
3=STRONG

Click to view IHC NCI60 Cell Line Array example
Antigen: 14-3-3 sigma

Background

NCI Identification Number:
10467
Antigen Name:
14-3-3 sigma
CPTC Name:
CPTC-SFN
Keywords:
SFN; HME1; Stratifin; OTTHUMP00000004242; YWHAS;
Function:
p53-regulated inhibitor of G2/M progression
Chromosomal Localization:
1p36.11
Expression System:
E. Coli
NCBI Accession Number:
BC000995
Swiss Prot Accession Number:
P31947
DNA Source:
HIP:HsCD00005964
Immunogen:
Recombinant Full Length Protein
Vector Name:
pMCSG7
Extinction Coefficient:
25963
Buffers:
50mM NH4HC03
Expressed Sequence:
SNAMERASLIQKAKLAEQAERYEDMAAFMKGAVEKGEELSCEERNLLSVAY
KNVVGGQRAAWRVLSSIEQKSNEEGSEEKGPEVREYREKVETELQGVCDTV
LGLLDSHLIKEAGDAESRVFYLKMKGDYYRYLAEVATGDDKKRIIDSARSA
YQEAMDISKKEMPPTNPIRLGLALNFSVFHYEIANSPEEAISLAKTTFDEA
MADLHTLSEDSYKDSTLIMQLLRDNLTLWTADNAGEEGGEAPQEPQS
Native Sequence:
MERASLIQKAKLAEQAERYEDMAAFMKGAVEKGEELSCEERNLLSVAYKN
VVGGQRAAWRVLSSIEQKSNEEGSEEKGPEVREYREKVETELQGVCDTVL
GLLDSHLIKEAGDAESRVFYLKMKGDYYRYLAEVATGDDKKRIIDSARSA
YQEAMDISKKEMPPTNPIRLGLALNFSVFHYEIANSPEEAISLAKTTFDE
AMADLHTLSEDSYKDSTLIMQLLRDNLTLWTADNAGEEGGEAPQEPQS
Calculated Isoelectric Point:
4.68
Molecular Weight:
28046
Last Updated:
11/14/2012

Links

Characterization Data

Gel

Click to enlarge image Immuno-histochemistry of CPTC-SFN-3 for NCI60  Cell Line Array at titer 1:500
0=NEGATIVE
1=WEAK
2=MODERATE
3=STRONG
Click to enlarge

CPTC-SFN PAGE

PAGE of Ag 10467 (CPTC-SFN) (with molecular weight standards in lane 1)

SOPs

Adobe Reader™ required.

Get Adobe Reader for free at Adobe.com