Skip to Content

Squamous cell carcinoma antigen 1

Antibody: CPTC-SERPINB3-1

Background

Catalog Number:
CPTC-SERPINB3-1
Target Antigen:
Squamous cell carcinoma antigen 1
Isotype:
IgG1
Species:
Mouse
Last Updated:
02/25/2013
Antigen Recognition(s):
recombinant full-length

Purchase

Characterization Data [Compare Characterization Data]

Western Blot

Click to enlarge image Western Blot using CPTC-SERPINB3-1 as primary Ab against Ag 10350 (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).
Click to enlarge

CPTC-SERPINB3-1 Western Blot

Western Blot using CPTC-SERPINB3-1 as primary Ab against Ag 10350 (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).

Cell Lysate Western Blot

Click to enlarge image Western Blot using CPTC-SERPINB3-1 as primary Ab against cell lysate from transiently overexpressed HEK293T cells form Origene (lane 3). Also included are molecular wt. standards (lane 1), lysate from non-transfected HEK293T cells as neg control (lane 4) and recombinant Ag SERPINB3 (NCI 10350) in (lane 2).
Click to enlarge

CPTC-SERPINB3-1 Cell Lysate blot

Western Blot using CPTC-SERPINB3-1 as primary Ab against cell lysate from transiently overexpressed HEK293T cells form Origene (lane 3). Also included are molecular wt. standards (lane 1), lysate from non-transfected HEK293T cells as neg control (lane 4) and recombinant Ag SERPINB3 (NCI 10350) in (lane 2).

Indirect ELISA

Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate)
Click to enlarge

CPTC-SERPINB3-1 Indirect ELISA

Indirect ELISA (ie, binding of Antibody to Antigen coated plate)

NCI 60 Protein Array

CPTC-SERPINB3-1 NCI 60 Protein Array

This antibody is not suitable for use in a Reverse Phase Protein Array format as described in SOP M-105.

IHC NCI60

CPTC-SERPINB3-1 IHC NCI60

This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.

Click to view IHC NCI60 Cell Line Array example

IHC Tissue

CPTC-SERPINB3-1 IHC Tissue

This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.

Antibody: CPTC-SERPINB3-2

Background

Catalog Number:
CPTC-SERPINB3-2
Target Antigen:
Squamous cell carcinoma antigen 1
Isotype:
IgG1
Species:
Mouse
Last Updated:
02/25/2013
Antigen Recognition(s):
recombinant full-length

Purchase

Characterization Data [Compare Characterization Data]

Western Blot

Click to enlarge image Western Blot using CPTC-SERPINB3-2 as primary Ab against Ag 10350 (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).
Click to enlarge

CPTC-SERPINB3-2 Western Blot

Western Blot using CPTC-SERPINB3-2 as primary Ab against Ag 10350 (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).

Cell Lysate Western Blot

Click to enlarge image Western Blot using CPTC-SERPINB3-2 as primary Ab against cell lysate from transiently overexpressed HEK293T cells form Origene (lane 3). Also included are molecular wt. standards (lane 1), lysate from non-transfected HEK293T cells as neg control (lane 4) and recombinant Ag SERPINB3 (NCI 10350) in (lane 2).
Click to enlarge

CPTC-SERPINB3-2 Cell Lysate blot

Western Blot using CPTC-SERPINB3-2 as primary Ab against cell lysate from transiently overexpressed HEK293T cells form Origene (lane 3). Also included are molecular wt. standards (lane 1), lysate from non-transfected HEK293T cells as neg control (lane 4) and recombinant Ag SERPINB3 (NCI 10350) in (lane 2).

Indirect ELISA

Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate)
Click to enlarge

CPTC-SERPINB3-2 Indirect ELISA

Indirect ELISA (ie, binding of Antibody to Antigen coated plate)

NCI 60 Protein Array

CPTC-SERPINB3-2 NCI 60 Protein Array

This antibody is not suitable for use in a Reverse Phase Protein Array format as described in SOP M-105.

IHC NCI60

CPTC-SERPINB3-2 IHC NCI60

This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.

Click to view IHC NCI60 Cell Line Array example

IHC Tissue

CPTC-SERPINB3-2 IHC Tissue

This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.

Antibody: CPTC-SERPINB3-3

Background

Catalog Number:
CPTC-SERPINB3-3
Target Antigen:
Squamous cell carcinoma antigen 1
Isotype:
IgG1
Species:
Mouse
Last Updated:
02/25/2013
Antigen Recognition(s):
recombinant full-length

Purchase

Characterization Data [Compare Characterization Data]

Western Blot

Click to enlarge image Western Blot using CPTC-SERPINB3-3 as primary Ab against Ag 10350 (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).
Click to enlarge

CPTC-SERPINB3-3 Western Blot

Western Blot using CPTC-SERPINB3-3 as primary Ab against Ag 10350 (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).

Cell Lysate Western Blot

Click to enlarge image Western Blot using CPTC-SERPINB3-3 as primary Ab against cell lysate from transiently overexpressed HEK293T cells form Origene (lane 3). Also included are molecular wt. standards (lane 1), lysate from non-transfected HEK293T cells as neg control (lane 4) and recombinant Ag SERPINB3 (NCI 10350) in (lane 2).
Click to enlarge

CPTC-SERPINB3-3 Cell Lysate blot

Western Blot using CPTC-SERPINB3-3 as primary Ab against cell lysate from transiently overexpressed HEK293T cells form Origene (lane 3). Also included are molecular wt. standards (lane 1), lysate from non-transfected HEK293T cells as neg control (lane 4) and recombinant Ag SERPINB3 (NCI 10350) in (lane 2).

Indirect ELISA

Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate)
Click to enlarge

CPTC-SERPINB3-3 Indirect ELISA

Indirect ELISA (ie, binding of Antibody to Antigen coated plate)

NCI 60 Protein Array

CPTC-SERPINB3-3 NCI 60 Protein Array

This antibody is not suitable for use in a Reverse Phase Protein Array format as described in SOP M-105.

IHC NCI60

CPTC-SERPINB3-3 IHC NCI60

This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.

Click to view IHC NCI60 Cell Line Array example

IHC Tissue

CPTC-SERPINB3-3 IHC Tissue

This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.

Antigen: Squamous cell carcinoma antigen 1

Background

NCI Identification Number:
10350
Antigen Name:
Squamous cell carcinoma antigen 1
CPTC Name:
CPTC-SERPINB3
Keywords:
SERPINB3; HsT1196; SCC; SCCA; SCCA-1; SCCA-PD; SCCA1; T4-A
Function:
May act as a protease inhibitor to modulate the host immune response against tumor cells
Chromosomal Localization:
18q21.3
Expression System:
E. Coli
NCBI Accession Number:
BC005224
Swiss Prot Accession Number:
P29508
DNA Source:
HIP:HsCD00004245
Immunogen:
Recombinant Full Length Protein
Vector Name:
pMCSG7
Extinction Coefficient:
39880
Buffers:
50mM NH4HC03
Expressed Sequence:
SNAMNSLSEANTKFMFDLFQQFRKSKENNIFYSPISITSALGMVLLGAKDNTAQQIKKVLHFDQVT
ENTTGKAATYHVDRSGNVHHQFQKLLTEFNKSTDAYELKIANKLFGEKTYLFLQEYLDAIKKFYQT
SVESVDFANAPEESRKKINSWVESQTNEKIKNLIPEGNIGSNTTLVLVNAIYFKGQWEKKFNKEDT
KEEKFWPNKNTYKSIQMMRQYTSFHFASLEDVQAKVLEIPYKGKDLSMIVLLPNEIDGLQKLEEKL
TAEKLMEWTSLQNMRETRVDLHLPRFKVEESYDLKDTLRTMGMVDIFNGDADLSGMTGSRGLVLSG
VLHKAFVEVTEEGAEAAAATAVVGFGSSPTSTNEEFHCNHPFLFFIRQNKTNSILFYGRFSSP
Native Sequence:
MNSLSEANTKFMFDLFQQFRKSKENNIFYSPISITSALGMVLLGAKDNTAQQIKKVLHFDQVTEN
TTGKAATYHVDRSGNVHHQFQKLLTEFNKSTDAYELKIANKLFGEKTYLFLQEYLDAIKKFYQTS
VESVDFANAPEESRKKINSWVESQTNEKIKNLIPEGNIGSNTTLVLVNAIYFKGQWEKKFNKEDT
KEEKFWPNKNTYKSIQMMRQYTSFHFASLEDVQAKVLEIPYKGKDLSMIVLLPNEIDGLQKLEEK
LTAEKLMEWTSLQNMRETRVDLHLPRFKVEESYDLKDTLRTMGMVDIFNGDADLSGMTGSRGLVL
SGVLHKAFVEVTEEGAEAAAATAVVGFGSSPTSTNEEFHCNHPFLFFIRQNKTNSILFYGRFSSP
Calculated Isoelectric Point:
6.34
Molecular Weight:
44837
Last Updated:
11/14/2012

Links

Characterization Data

Gel

Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate)
Click to enlarge

Ag 10350

PAGE of Ag 10350 with molecular weight standards (lane 1)

SOPs

Adobe Reader™ required.

Get Adobe Reader for free at Adobe.com