Skip to Content

Spermidine or Spermine N1-Acetyltransferase 1

Antibody: CPTC-SAT1-1

Background

Catalog Number:
CPTC-SAT1-1
Target Antigen:
Spermidine or Spermine N1-Acetyltransferase 1
Isotype:
IgG2b
Species:
Mouse
Last Updated:
03/07/2013
Antigen Recognition(s):
recombinant full-length

Purchase

Characterization Data [Compare Characterization Data]

Western Blot

Click to enlarge image Western Blot using CPTC-SAT1-1 as primary Ab against rAg 10026 (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).
Click to enlarge

CPTC-SAT1-1 Western Blot

Western Blot using CPTC-SAT1-1 as primary Ab against rAg 10026 (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).

Characterization SOP Files

Indirect ELISA

Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate)
Click to enlarge

CPTC-SAT1-1 Indirect ELISA

Indirect ELISA (ie, binding of Antibody to Antigen coated plate)

Characterization SOP Files

NCI 60 Protein Array

CPTC-SAT1-1 NCI 60 Protein Array

This antibody is not suitable for use in a Reverse Phase Protein Array format as described in SOP M-105.

IHC NCI60

CPTC-SAT1-1 IHC NCI60

This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.

Click to view IHC NCI60 Cell Line Array example
Array

IHC Tissue

CPTC-SAT1-1 IHC Tissue

This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.

SPR

Click to enlarge image This summarizes the kinetic data obtained with CPTC-SAT1-1
Click to enlarge

Kinetic Data for CPTC-SAT1-1

This summarizes the kinetic data obtained with CPTC-SAT1-1

SPR

Download SAT1 pairing.pdf (792.1 KB)

Antibody Pairing Summary

This file summarizes pairing studies by SPR.

Antibody: CPTC-SAT1-2

Background

Catalog Number:
CPTC-SAT1-2
Target Antigen:
Spermidine or Spermine N1-Acetyltransferase 1
Isotype:
IgG1
Species:
Mouse
Last Updated:
03/07/2013
Antigen Recognition(s):

Purchase

Characterization Data [Compare Characterization Data]

Western Blot

Click to enlarge image Western Blot using CPTC-SAT1-2 as primary Ab against rAg 10026 (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).
Click to enlarge

CPTC-SAT1-2 Western Blot

Western Blot using CPTC-SAT1-2 as primary Ab against rAg 10026 (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).

Characterization SOP Files

Indirect ELISA

Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate)
Click to enlarge

CPTC-SAT1-2 Indirect ELISA

Indirect ELISA (ie, binding of Antibody to Antigen coated plate)

Characterization SOP Files

NCI 60 Protein Array

CPTC-SAT1-2 NCI 60 Protein Array

This antibody is not suitable for use in a Reverse Phase Protein Array format as described in SOP M-105.

IHC NCI60

CPTC-SAT1-2 IHC NCI60

This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.

Click to view IHC NCI60 Cell Line Array example

IHC Tissue

CPTC-SAT1-2 IHC Tissue

This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.

IHC HPA

Download CPTC-SAT1-2.pdf (94.7 KB)

CPTC SAT1-2 Evaluation by Human Protein Atlas

This PDF contains the evaluation results provided by the Human Protein Atlas (www.proteinatlas.org)

Array

SPR

Click to enlarge image This summarizes the kinetic data for CPTC-SAT1-2
Click to enlarge

Kinetic Data for CPTC-SAT1-2

This summarizes the kinetic data for CPTC-SAT1-2

SPR

Download SAT1 pairing.pdf (792.1 KB)

Antibody Pairing Summary

This file summarizes pairing studies by SPR.

Antibody: CPTC-SAT1-3

Background

Catalog Number:
CPTC-SAT1-3
Target Antigen:
Spermidine or Spermine N1-Acetyltransferase 1
Isotype:
IgG2a
Species:
Mouse
Last Updated:
03/07/2013
Antigen Recognition(s):

Purchase

External Links

Characterization Data [Compare Characterization Data]

Western Blot

Click to enlarge image Western Blot using CPTC-SAT1-3 as primary Ab against rAg 10026 (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).
Click to enlarge

CPTC-SAT1-3 Western Blot

Western Blot using CPTC-SAT1-3 as primary Ab against rAg 10026 (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).

Indirect ELISA

Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate)
Click to enlarge

CPTC-SAT1-3 Indirect ELISA

Indirect ELISA (ie, binding of Antibody to Antigen coated plate)

Characterization SOP Files

NCI 60 Protein Array

CPTC-SAT1-3 Protein Array

This antibody is not suitable for use in a Reverse Phase Protein Array format as described in SOP M-105.

IHC HPA

Download CPTC-SAT1-3.pdf (103.2 KB)

CPTC-SAT1-3 Evaluation by Human Protein Atlas

This PDF contains the evaluation results provided by the Human Protein Atlas (www.proteinatlas.org)

Array

SPR

Download SAT1 pairing.pdf (792.1 KB)

Antibody Pairing Summary

This file summarizes pairing studies by SPR.

SPR

Click to enlarge image This summarizes the kinetic data for CPTC-SAT1-3
Click to enlarge

Kinetic Data for CPTC-SAT1-3

This summarizes the kinetic data for CPTC-SAT1-3

Antigen: Spermidine or Spermine N1-Acetyltransferase 1

Background

NCI Identification Number:
10026
Antigen Name:
Spermidine or Spermine N1-Acetyltransferase 1
CPTC Name:
CPTC-SAT1
Keywords:
SAT1; SAT; SAT-1; SSAT; SSAT-1; DC21; KFSD; OTTHUMP00000023061
Function:
Spermidine/spermine N(1)-acetyltransferase (SSAT; EC 2.3.1.57) is a rate-limiting enzyme in the catabolic pathway of polyamine metabolism. It catalyzes the N(1)-acetylation of spermidine and spermine and, by the successive activity of polyamine oxidase, spermine can be converted to spermidine and spermidine to putrescine

High affinity uptake of sulfate. Accepts oxalate, but not succinate as a cosubstrate (By similarity).
Chromosomal Localization:
Xp22.1
Expression System:
E. Coli
NCBI Accession Number:
BC002503
Swiss Prot Accession Number:
Q9H2B4
DNA Source:
INV : 6169298
Immunogen:
Recombinant Full Length Protein
Vector Name:
pMCSG7
Extinction Coefficient:
37025
Buffers:
50mM NH4HC03
Expressed Sequence:
SNAMAKFVIRPATAADCSDILRLIKELAKYEYMEE
QVILTEKDLLEDGFGEHPFYHCLVAEVPKEHWTPE
GHSIVGFAMYYFTYDPWIGKLLYLEDFFVMSDYRG
FGIGSEILKNLSQVAMRCRCSSMHFLVAEWNEPSI
NFYKRRGASDLSSEEGWRLFKIDKEYLLKMATEE
Native Sequence:
MAKFVIRPATAADCSDILRLIKELAKYEYMEEQVI
LTEKDLLEDGFGEHPFYHCLVAEVPKEHWTPEGHS
IVGFAMYYFTYDPWIGKLLYLEDFFVMSDYRGFGI
GSEILKNLSQVAMRCRCSSMHFLVAEWNEPSINFY
KRRGASDLSSEEGWRLFKIDKEYLLKMATEE
Calculated Isoelectric Point:
5.09
Molecular Weight:
20296
Last Updated:
11/14/2012

Links

Characterization Data

Gel

Click to enlarge image This summarizes the kinetic data for CPTC-SAT1-3
Click to enlarge

CPTC-SAT1 PAGE

PAGE of SAT1 (rAg 10026) with molecular weight standards (lane 1)

SOPs

Adobe Reader™ required.

Get Adobe Reader for free at Adobe.com