Skip to Content

RAD52 homolog (S. cerevisiae)

Antibody: CPTC-RAD52-1

Background

Catalog Number:
CPTC-RAD52-1
Target Antigen:
RAD52 homolog (S. cerevisiae)
Isotype:
IgG1
Species:
Mouse
Last Updated:
02/26/2013
Antigen Recognition(s):
recombinant full-length

Purchase

Characterization Data [Compare Characterization Data]

Western Blot

Click to enlarge image Western Blot using CPTC-RAD52-1 as primary Ab against PNMT (rAg 10468) in lane 2. Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).
Click to enlarge

CPTC-RAD52-1 Western blot

Western Blot using CPTC-RAD52-1 as primary Ab against PNMT (rAg 10468) in lane 2. Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).

Indirect ELISA

Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding.
Click to enlarge

CPTC-RAD52-1 Indirect ELISA

Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding.

NCI 60 Protein Array

CPTC-RAD52-1 NCI 60 Protein Array

This antibody is not suitable for use in a Reverse Phase Protein Array format as described in SOP M-105.

IHC NCI60

CPTC-RAD52-1 IHC NCI60

This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.

Click to view IHC NCI60 Cell Line Array example

IHC Tissue

CPTC-RAD52-1 IHC Tissue

This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.

Antibody: CPTC-RAD52-2

Background

Catalog Number:
CPTC-RAD52-2
Target Antigen:
RAD52 homolog (S. cerevisiae)
Isotype:
IgG2a
Species:
Mouse
Last Updated:
02/26/2013
Antigen Recognition(s):
recombinant full-length

Purchase

Characterization Data [Compare Characterization Data]

Western Blot

Click to enlarge image Western Blot using CPTC-RAD52-2 as primary Ab against PNMT (rAg 10468) in lane 2. Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).
Click to enlarge

CPTC-RAD52-2 Western blot

Western Blot using CPTC-RAD52-2 as primary Ab against PNMT (rAg 10468) in lane 2. Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).

Indirect ELISA

Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding.
Click to enlarge

CPTC-RAD52-2 Indirect ELISA

Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding.

NCI 60 Protein Array

CPTC-RAD52-2 NCI 60 Protein Array

This antibody is not suitable for use in a Reverse Phase Protein Array format as described in SOP M-105.

IHC NCI60

CPTC-RAD52-2 IHC NCI60

This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.

Click to view IHC NCI60 Cell Line Array example

IHC Tissue

CPTC-RAD52-2 IHC Tissue

This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.

Antibody: CPTC-RAD52-3

Background

Catalog Number:
CPTC-RAD52-3
Target Antigen:
RAD52 homolog (S. cerevisiae)
Isotype:
IgG1
Species:
Mouse
Last Updated:
02/26/2013
Antigen Recognition(s):
recombinant full-length

Purchase

Characterization Data [Compare Characterization Data]

Western Blot

Click to enlarge image Western Blot using CPTC-RAD52-3 as primary Ab against PNMT (rAg 10468) in lane 2. Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).
Click to enlarge

CPTC-RAD52-3 Western blot

Western Blot using CPTC-RAD52-3 as primary Ab against PNMT (rAg 10468) in lane 2. Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).

Indirect ELISA

Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding.
Click to enlarge

CPTC-RAD52-3 Indirect ELISA

Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding.

NCI 60 Protein Array

CPTC-RAD52-3 NCI 60 Protein Array

This antibody is not suitable for use in a Reverse Phase Protein Array format as described in SOP M-105.

IHC NCI60

CPTC-RAD52-3 IHC NCI60

This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.

Click to view IHC NCI60 Cell Line Array example

IHC Tissue

CPTC-RAD52-3 IHC Tissue

This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.

Antigen: RAD52 homolog (S. cerevisiae)

Background

NCI Identification Number:
10468
Antigen Name:
RAD52 homolog (S. cerevisiae)
CPTC Name:
CPTC-RAD52
Keywords:
RAD52 homolog (S. cerevisiae); DNA repair protein RAD52 homolog; recombination protein RAD52; rhabdomyosarcoma antigen MU-RMS-40.23;
Function:
The protein encoded by this gene shares similarity with Saccharomyces cerevisiae Rad52, a protein important for DNA double-strand break repair and homologous recombination. This gene product was shown to bind single-stranded DNA ends, and mediate the DNA-DNA interaction necessary for the annealing of complementary DNA strands. It was also found to interact with DNA recombination protein RAD51, which suggested its role in RAD51 related DNA recombination and repair.

Involved in double-stranded break repair. Plays a central role in genetic recombination and DNA repair by
promoting the annealing of complementary single-stranded DNA and by stimulation of the RAD51 recombinase
Chromosomal Localization:
12p13-p12.2
Expression System:
E. Coli
NCBI Accession Number:
U12134.1
Swiss Prot Accession Number:
P43351
DNA Source:
DNASU - HsCD00022279
Immunogen:
Recombinant Full Length Protein
Vector Name:
pMCSG7
Extinction Coefficient:
40130
Buffers:
PBS without Ca++ and Mg++
Expressed Sequence:
SNAMSGTEEAILGGRDSHPAAGGGSVLCFGQCQYTAEEYQAIQKALR
QRLGPEYISSRMAGGGQKVCYIEGHRVINLANEMFGYNGWAHSITQQ
NVDFVDLNNGKFYVGVCAFVRVQLKDGSYHEDVGYGVSEGLKSKALS
LEKARKEAVTDGLKRALRSFGNALGNCILDKDYLRSLNKLPRQLPLE
VDLTKAKRQDLEPSVEEARYNSCRPNMALGHPQLQQVTSPSRPSHAV
IPADQDCSSRSLSSSAVESEATHQRKLRQKQLQQQFRERMEKQQVRV
STPSAEKSEAAPPAPPVTHSTPVTVSEPLLEKDFLAGVTQELIKTLE
DNSEKWAVTPDAGDGVVKPSSRADPAQTSDTLALNNQMVTQNRTPHS
VCHQKPQAKSGSWDLQTYSADQRTTGNWESHRKSQDMKKRKYDPS
Native Sequence:
MSGTEEAILGGRDSHPAAGGGSVLCFGQCQYTAEEYQAIQKALRQRL
GPEYISSRMAGGGQKVCYIEGHRVINLANEMFGYNGWAHSITQQNVD
FVDLNNGKFYVGVCAFVRVQLKDGSYHEDVGYGVSEGLKSKALSLEK
ARKEAVTDGLKRALRSFGNALGNCILDKDYLRSLNKLPRQLPLEVDL
TKAKRQDLEPSVEEARYNSCRPNMALGHPQLQQVTSPSRPSHAVIPA
DQDCSSRSLSSSAVESEATHQRKLRQKQLQQQFRERMEKQQVRVSTP
SAEKSEAAPPAPPVTHSTPVTVSEPLLEKDFLAGVTQELIKTLEDNS
EKWAVTPDAGDGVVKPSSRADPAQTSDTLALNNQMVTQNRTPHSVCH
QKPQAKSGSWDLQTYSADQRTTGNWESHRKSQDMKKRKYDPS
Calculated Isoelectric Point:
8.49
Molecular Weight:
46441
Last Updated:
11/14/2012

Links

Characterization Data

Gel

Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding.
Click to enlarge

CPTC-RAD52 PAGE

PAGE of Ag 10468(with molecular weight standards in lane 1)

SOPs

Adobe Reader™ required.

Get Adobe Reader for free at Adobe.com