Skip to Content

Ras-related C3 botulinum toxin substrate 1 (rho family small GTP binding protein Rac1)

Antibody: CPTC-RAC1-1

Background

Catalog Number:
CPTC-RAC1-1
Target Antigen:
Ras-related C3 botulinum toxin substrate 1 (rho family small GTP binding protein Rac1)
Isotype:
IgG1
Species:
Mouse
Last Updated:
02/25/2013
Antigen Recognition(s):
recombinant full-length

Purchase

External Links

Characterization Data [Compare Characterization Data]

Western Blot

Click to enlarge image Western Blot Using CPTC-RAC1-1 as primary Ab against Ag 10295(Lane 2). Also included are Molecular Weight markers (Lane 1) and mouse IgG positive control (Lane 3).
Click to enlarge

CPTC-RAC1-1 Western Blot

Western Blot Using CPTC-RAC1-1 as primary Ab against Ag 10295(Lane 2). Also included are Molecular Weight markers (Lane 1) and mouse IgG positive control (Lane 3).

Indirect ELISA

Click to enlarge image Indirect ELISA of CPTC-RAC1-1
Click to enlarge

CPTC-RAC1-1 Indirect ELISA

Indirect ELISA of CPTC-RAC1-1

NCI 60 Protein Array

CPTC-RAC1-1 NCI 60 Protein Array

This antibody is not suitable for use in a Reverse Phase Protein Array format as described in SOP M-105.

IHC NCI60

CPTC-RAC1-1 IHC NCI60

This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.

Click to view IHC NCI60 Cell Line Array example

IHC Tissue

CPTC-RAC1-1 IHC Tissue

This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.

Antibody: CPTC-RAC1-2

Background

Catalog Number:
CPTC-RAC1-2
Target Antigen:
Ras-related C3 botulinum toxin substrate 1 (rho family small GTP binding protein Rac1)
Isotype:
IgG2b
Species:
Mouse
Last Updated:
03/07/2013
Antigen Recognition(s):

Purchase

Characterization Data [Compare Characterization Data]

Western Blot

Click to enlarge image Western Blot Using CPTC-RAC1-2 as primary Ab against Ag 10295(Lane 2). Also included are Molecular Weight markers (Lane 1) and mouse IgG positive control (Lane 3).
Click to enlarge

CPTC-RAC1-2 Western Blot

Western Blot Using CPTC-RAC1-2 as primary Ab against Ag 10295(Lane 2). Also included are Molecular Weight markers (Lane 1) and mouse IgG positive control (Lane 3).

Indirect ELISA

Click to enlarge image Indirect ELISA of CPTC-RAC1-2
Click to enlarge

CPTC-RAC1-2 Indirect ELISA

Indirect ELISA of CPTC-RAC1-2

NCI 60 Protein Array

Click to enlarge image Protein Array in which CPTC-RAC1-2 is screened against the NCI60 cell line panel for expression. Data is normalized to a mean signal of 1.0 and standard deviation of 0.5.
Click to enlarge

CPTC-RAC1-2 NCI 60 Protein Array

Protein Array in which CPTC-RAC1-2 is screened against the NCI60 cell line panel for expression. Data is normalized to a mean signal of 1.0 and standard deviation of 0.5.

IHC NCI60

Click to enlarge image Immuno-histochemistry of CPTC-RAC1-2 for NCI60  Cell Line Array at titer 1:50
0=NEGATIVE
1=WEAK
2=MODERATE
3=STRONG
Click to enlarge

CPTC-RAC1-2 IHC NCI60

Immuno-histochemistry of CPTC-RAC1-2 for NCI60 Cell Line Array at titer 1:50
0=NEGATIVE
1=WEAK
2=MODERATE
3=STRONG

Click to view IHC NCI60 Cell Line Array example
Antigen: Ras-related C3 botulinum toxin substrate 1 (rho family small GTP binding protein Rac1)

Background

NCI Identification Number:
10295
Antigen Name:
Ras-related C3 botulinum toxin substrate 1 (rho family small GTP binding protein Rac1)
CPTC Name:
CPTC-RAC1
Keywords:
RAC1; MGC111543; MIG5; PAK1; TC-25; p21-Rac1
Function:
Isoform B has an accelerated GEF-independent GDP/GTP exchange and an impaired GTP hydrolysis, which is restored partially by GTPase-activating proteins. It is able to bind to the GTPase-binding domain of PAK but not full-length PAK in a GTP-dependent manner, suggesting that the insertion does not completely abolish effector interaction
Chromosomal Localization:
7p22
Expression System:
E. Coli
NCBI Accession Number:
BC004247
Swiss Prot Accession Number:
P63000
DNA Source:
HIP:HsCD00003506
Immunogen:
Recombinant Full Length Protein
Vector Name:
pMCSG7
Extinction Coefficient:
23108
Buffers:
50mM NH4HC03
Expressed Sequence:
SNAMQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVF
DNYSANVMVDGKPVNLGLWDTAGQEDYDRLRPLSYPQTDV
FLICFSLVSPASFENVRAKWYPEVRHHCPNTPIILVGTKL
DLRDDKDTIEKLKEKKLIPITYPQGLAMAKEIGAVKYLEC
SAL TQRGLKTVFDEAIRAVLCPPPVKKRKRKCLLL
Native Sequence:
MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDN
YSANVMVDGKPVNLGLWDTAGQEDYDRLRPLSYPQTDVF
LICFSLVSPASFENVRAKWYPEVRHHCPNTPIILVGTKL
DLRDDKDTIEKLKEKKLIPITYPQGLAMAKEIGAVKYLE
CSALTQRGLKTVFDEAIRAVLCPPPVKKRKRKCLLL
Calculated Isoelectric Point:
8.77
Molecular Weight:
21734
Last Updated:
11/14/2012

Links

Characterization Data

Gel

Click to enlarge image Immuno-histochemistry of CPTC-RAC1-2 for NCI60  Cell Line Array at titer 1:50
0=NEGATIVE
1=WEAK
2=MODERATE
3=STRONG
Click to enlarge

Ag 10295

PAGE of Ag 10295 with molecular weight standards

SOPs

Adobe Reader™ required.

Get Adobe Reader for free at Adobe.com