Skip to Content

26S proteasome non-ATPase regulatory subunit 4

Antibody: CPTC-PSMD4-1

Background

Catalog Number:
CPTC-PSMD4-1
Target Antigen:
26S proteasome non-ATPase regulatory subunit 4
Isotype:
IgG2b
Species:
Mouse
Last Updated:
02/28/2013
Antigen Recognition(s):

Purchase

Characterization Data [Compare Characterization Data]

Western Blot

Click to enlarge image Western Blot using CPTC-PSMD4-1 as primary Ab against rAg 11015 (PSMD4) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG as control for goat anti-mouse HRP secondary binding (lane 3).
Click to enlarge

CPTC-PSMD4-1 Western blot

Western Blot using CPTC-PSMD4-1 as primary Ab against rAg 11015 (PSMD4) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG as control for goat anti-mouse HRP secondary binding (lane 3).

Cell Lysate Western Blot

Click to enlarge image Western Blot using CPTC-PSMD4-1 as primary Ab against cell lysate from transiently overexpressed HEK293T cells form Origene (lane 2). Also included are molecular wt. standards (lane 1), lysate from non-transfected HEK293T cells as neg control (lane 3) and recombinant Ag PSMD4 (NCI 11015) in (lane 4).
Click to enlarge

CPTC-PSMD4-1 Cell Lysate Western blot

Western Blot using CPTC-PSMD4-1 as primary Ab against cell lysate from transiently overexpressed HEK293T cells form Origene (lane 2). Also included are molecular wt. standards (lane 1), lysate from non-transfected HEK293T cells as neg control (lane 3) and recombinant Ag PSMD4 (NCI 11015) in (lane 4).

Indirect ELISA

Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate)
Click to enlarge

CPTC-PSMD4-1 Indirect ELISA

Indirect ELISA (ie, binding of Antibody to Antigen coated plate)

NCI 60 Protein Array

CPTC-PSMD4-1 NCI 60 Protein Array

This antibody is not suitable for use in a Reverse Phase Protein Array format as described in SOP M-105.

IHC NCI60

CPTC-PSMD4-1 IHC NCI60

This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.

Click to view IHC NCI60 Cell Line Array example

IHC Tissue

CPTC-PSMD4-1 IHC Tissue

This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.

IHC HPA

Download CPTC-PSMD4-1.pdf (91.2 KB)

CPTC-PSMD4-1 Evaluation by the Human Protein Atlas

This PDF contains the evaluation results provided by the Human Protein Atlas (www.proteinatlas.org)

Antibody: CPTC-PSMD4-2

Background

Catalog Number:
CPTC-PSMD4-2
Target Antigen:
26S proteasome non-ATPase regulatory subunit 4
Isotype:
IgG1
Species:
Mouse
Last Updated:
01/24/2013
Antigen Recognition(s):

Purchase

Characterization Data [Compare Characterization Data]

Western Blot

Click to enlarge image Western Blot using CPTC-PSMD4-2 as primary Ab against rAg 11015 (PSMD4) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG as control for goat anti-mouse HRP secondary binding (lane 3).
Click to enlarge

CPTC-PSMD4-2 Western blot

Western Blot using CPTC-PSMD4-2 as primary Ab against rAg 11015 (PSMD4) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG as control for goat anti-mouse HRP secondary binding (lane 3).

Cell Lysate Western Blot

Click to enlarge image Western Blot using CPTC-PSMD4-2 as primary Ab against cell lysate from transiently overexpressed HEK293T cells form Origene (lane 2). Also included are molecular wt. standards (lane 1), lysate from non-transfected HEK293T cells as neg control (lane 3) and recombinant Ag PSMD4 (NCI 11015) in (lane 4).
Click to enlarge

CPTC-PSMD4-2 Cell Lysate Western blot

Western Blot using CPTC-PSMD4-2 as primary Ab against cell lysate from transiently overexpressed HEK293T cells form Origene (lane 2). Also included are molecular wt. standards (lane 1), lysate from non-transfected HEK293T cells as neg control (lane 3) and recombinant Ag PSMD4 (NCI 11015) in (lane 4).

Indirect ELISA

Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate)
Click to enlarge

CPTC-PSMD4-2 Indirect ELISA

Indirect ELISA (ie, binding of Antibody to Antigen coated plate)

NCI 60 Protein Array

Click to enlarge image Protein Array in which CPTC-PSMD4-2 is screened against the NCI60 cell line panel for expression. Data is normalized to a mean signal of 1.0 and standard deviation of 0.5. Color conveys over-expression level (green), basal level (blue), under-expression level (red).
Click to enlarge

CPTC-PSMD4-2 Protein Array

Protein Array in which CPTC-PSMD4-2 is screened against the NCI60 cell line panel for expression. Data is normalized to a mean signal of 1.0 and standard deviation of 0.5. Color conveys over-expression level (green), basal level (blue), under-expression level (red).

IHC HPA

Download CPTC-PSMD4-2.pdf (86.2 KB)

CPTC-PSMD4-2 Evaluation by the Human Protein Atlas

This PDF contains the evaluation results provided by the Human Protein Atlas (www.proteinatlas.org)

Antibody: CPTC-PSMD4-3

Background

Catalog Number:
CPTC-PSMD4-3
Target Antigen:
26S proteasome non-ATPase regulatory subunit 4
Isotype:
IgG2b
Species:
Mouse
Last Updated:
11/26/2013
Antigen Recognition(s):

Purchase

External Links

Characterization Data [Compare Characterization Data]

Western Blot

Click to enlarge image Western Blot using CPTC-PSMD4-3 as primary Ab against rAg 11015 (PSMD4) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG as control for goat anti-mouse HRP secondary binding (lane 3).
Click to enlarge

CPTC-PSMD4-3 Western blot

Western Blot using CPTC-PSMD4-3 as primary Ab against rAg 11015 (PSMD4) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG as control for goat anti-mouse HRP secondary binding (lane 3).

Cell Lysate Western Blot

Click to enlarge image Western Blot using CPTC-PSMD4-3 as primary Ab against cell lysate from transiently overexpressed HEK293T cells form Origene (lane 2). Also included are molecular wt. standards (lane 1), lysate from non-transfected HEK293T cells as neg control (lane 3) and recombinant Ag PSMD4 (NCI 11015) in (lane 4).
Click to enlarge

CPTC-PSMD4-3 Cell Lysate Western blot

Western Blot using CPTC-PSMD4-3 as primary Ab against cell lysate from transiently overexpressed HEK293T cells form Origene (lane 2). Also included are molecular wt. standards (lane 1), lysate from non-transfected HEK293T cells as neg control (lane 3) and recombinant Ag PSMD4 (NCI 11015) in (lane 4).

Indirect ELISA

Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate)
Click to enlarge

CPTC-PSMD4-3 Indirect ELISA

Indirect ELISA (ie, binding of Antibody to Antigen coated plate)

NCI 60 Protein Array

Click to enlarge image Protein Array in which CPTC-PSMD4-3 is screened against the NCI60 cell line panel for expression. Data is normalized to a mean signal of 1.0 and standard deviation of 0.5. Color conveys over-expression level (green), basal level (blue), under-expression level (red).
Click to enlarge

CPTC-PSMD4-3 Protein Array

Protein Array in which CPTC-PSMD4-3 is screened against the NCI60 cell line panel for expression. Data is normalized to a mean signal of 1.0 and standard deviation of 0.5. Color conveys over-expression level (green), basal level (blue), under-expression level (red).

IHC Tissue

Click to enlarge image Tissue Micro-Array(TMA) core of colon cancer  showing cytoplasmic staining using Antibody CPTC-PSMD4-3. Titer: 1:500
Click to enlarge

CPTC-PSMD4-3 IHC Tissue

Tissue Micro-Array(TMA) core of colon cancer showing cytoplasmic staining using Antibody CPTC-PSMD4-3. Titer: 1:500

IHC HPA

Download CPTC-PSMD4-3.pdf (103.7 KB)

CPTC-PSMD4-3 Evaluation by the Human Protein Atlas

This PDF contains the evaluation results provided by the Human Protein Atlas (www.proteinatlas.org)

Antigen: 26S proteasome non-ATPase regulatory subunit 4

Background

NCI Identification Number:
11015
Antigen Name:
26S proteasome non-ATPase regulatory subunit 4
CPTC Name:
CPTC-PSMD4
Keywords:
AF; AF-1; ASF; MCB1; OTTHUMP00000014286; OTTHUMP00000059963; Rpn10; S5A; angiocidin; pUB-R5
Function:
The 26S proteasome is a multicatalytic proteinase complex with a highly ordered structure composed of 2 complexes, a 20S core and a 19S regulator. The 20S core is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. The 19S regulator is composed of a base, which contains 6 ATPase subunits and 2 non-ATPase subunits, and a lid, which contains up to 10 non-ATPase subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. This gene encodes one of the non-ATPase subunits of the 19S regulator lid. Pseudogenes have been identified on chromosomes 10 and 21.

Binds and presumably selects ubiquitin-conjugates for destruction. Displays selectivity for longer polyubiquitin chains. Modulates intestinal fluid secretion.
Chromosomal Localization:
1q21.2
Expression System:
E. Coli
NCBI Accession Number:
BC072008.1
Swiss Prot Accession Number:
P55036
DNA Source:
OB : MHS1011-98054211
Immunogen:
Recombinant Full Length Protein
Vector Name:
pMCSG7
Extinction Coefficient:
4595
Buffers:
PBS
Expressed Sequence:
SNAMVLESTMVCVDNSEYMRNGDFLPTRLQAQQDAVNIVCHSKTRSNPENNVGLITLANDCEVL
TTLTPDTGRILSKLHTVQPKGKITFCTGIRVAHLALKHRQGKNHKMRIIAFVGSPVEDNEKDLV
KLAKRLKKEKVNVDIINFGEEEVNTEKLTAFVNTLNGKDGTGSHLVTVPPGPSLADALISSPIL
AGEGGAMLGLGASDFEFGVDPSADPELALALRVSMEEQRQRQEEEARRAAAASAAEAGIATTGT
EDSDDALLKMTISQQEFGRTGLPDLSSMTEEEQIAYAMQMSLQGAEFGQAESADIDASSAMDTS
EPAKEEDDYDVMQDPEFLQSVLENLPGVDPNNEAIRNAMGSLASQATKDGKKDKKEEDKK
Native Sequence:
MVLESTMVCVDNSEYMRNGDFLPTRLQAQQDAVNIVCHSKTRSNPENNVGLITLANDCEVLTT
LTPDTGRILSKLHTVQPKGKITFCTGIRVAHLALKHRQGKNHKMRIIAFVGSPVEDNEKDLVK
LAKRLKKEKVNVDIINFGEEEVNTEKLTAFVNTLNGKDGTGSHLVTVPPGPSLADALISSPIL
AGEGGAMLGLGASDFEFGVDPSADPELALALRVSMEEQRQRQEEEARRAAAASAAEAGIATTG
TEDSDDALLKMTISQQEFGRTGLPDLSSMTEEEQIAYAMQMSLQGAEFGQAESADIDASSAMD
TSEPAKEEDDYDVMQDPEFLQSVLENLPGVDPNNEAIRNAMGSLASQATKDGKKDKKEEDKK
Calculated Isoelectric Point:
4.68
Molecular Weight:
40.74
Last Updated:
11/14/2012

Links

Characterization Data

Gel

Click to enlarge image Tissue Micro-Array(TMA) core of colon cancer  showing cytoplasmic staining using Antibody CPTC-PSMD4-3. Titer: 1:500
Click to enlarge

CPTC-PSMD4 SDS-PAGE

PAGE of PSMD4 (Ag 11015) with molecular weight standards in lane 1

SOPs

Adobe Reader™ required.

Get Adobe Reader for free at Adobe.com