Skip to Content

Peroxiredoxin 4

Antibody: CPTC-PRDX4-1

Background

Catalog Number:
CPTC-PRDX4-1
Target Antigen:
Peroxiredoxin 4
Isotype:
IgG2a
Species:
Mouse
Last Updated:
01/24/2012
Antigen Recognition(s):
recombinant full-length

Purchase

Characterization Data [Compare Characterization Data]

Western Blot

Click to enlarge image Western Blot using CPTC-PRDX4-1 as primary Ab against Ag 10604 (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).
Click to enlarge

CPTC-PRDX4-1 Western Blot

Western Blot using CPTC-PRDX4-1 as primary Ab against Ag 10604 (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).

Cell Lysate Western Blot

Click to enlarge image Western Blot using CPTC-PRDX4-1 as primary Ab against cell lysate from transiently overexpressed HEK293T cells form Origene (lane 3). Also included are molecular wt. standards (lane 1), lysate from non-transfected HEK293T cells as neg control (lane 4) and recombinant Ag PRDX4 (NCI 10604) in (lane 2).
Click to enlarge

CPTC-PRDX4-1 Cell Lysate Western blot

Western Blot using CPTC-PRDX4-1 as primary Ab against cell lysate from transiently overexpressed HEK293T cells form Origene (lane 3). Also included are molecular wt. standards (lane 1), lysate from non-transfected HEK293T cells as neg control (lane 4) and recombinant Ag PRDX4 (NCI 10604) in (lane 2).

Indirect ELISA

Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate)
Click to enlarge

CPTC-PRDX4-1 Indirect ELISA

Indirect ELISA (ie, binding of Antibody to Antigen coated plate)

NCI 60 Protein Array

Click to enlarge image Protein Array in which CPTC-PRDX4-1 is screened against the NCI60 cell line panel for expression. Data is normalized to a mean signal of 1.0 and standard deviation of 0.5. Color conveys over-expression level (green), basal level (blue), under-expression level (red).
Click to enlarge

CPTC-PRDX4-1 Protein Array

Protein Array in which CPTC-PRDX4-1 is screened against the NCI60 cell line panel for expression. Data is normalized to a mean signal of 1.0 and standard deviation of 0.5. Color conveys over-expression level (green), basal level (blue), under-expression level (red).

IHC NCI60

Click to enlarge image Immunohistochemistry of CPTC-PRDX4-1 for NCI60 Cell Line Array. Data scored as:
0=NEGATIVE
1=WEAK (red)
2=MODERATE (blue)
3=STRONG (green)
Titer: 1:5000
Click to enlarge

CPTC-PRDX4-1 IHC NCI60

Immunohistochemistry of CPTC-PRDX4-1 for NCI60 Cell Line Array. Data scored as:
0=NEGATIVE
1=WEAK (red)
2=MODERATE (blue)
3=STRONG (green)
Titer: 1:5000

Click to view IHC NCI60 Cell Line Array example

IHC Tissue

Click to enlarge image Tissue Micro-Array(TMA) core of colon cancer showing cytoplasmic staining using Antibody CPTC-PRDX4-1. Titer: 1:5000
Click to enlarge

CPTC-PRDX4-1 IHC Tissue

Tissue Micro-Array(TMA) core of colon cancer showing cytoplasmic staining using Antibody CPTC-PRDX4-1. Titer: 1:5000

IHC HPA

Download PRDX4-1 HPA Report.pdf (522.7 KB)

CPTC-PRDX-1 evaluation by the Human Protein Atlas

This PDF provides the evaluation results as provided by the Human Protein Atlas (www.proteinatlas.org).

SPR

Click to enlarge image Kinetic titration data for PRDX4-1 Ab (632A11.1) using Biacore SPR method
Click to enlarge

CPTC-PRDX4-1 SPR

Kinetic titration data for PRDX4-1 Ab (632A11.1) using Biacore SPR method

Antibody: CPTC-PRDX4-2

Background

Catalog Number:
CPTC-PRDX4-2
Target Antigen:
Peroxiredoxin 4
Isotype:
IgG2b
Species:
Mouse
Last Updated:
01/24/2012
Antigen Recognition(s):
recombinant full-length

Purchase

External Links

Characterization Data [Compare Characterization Data]

Western Blot

Click to enlarge image Western Blot using CPTC-PRDX4-2 as primary Ab against Ag 10604 (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).
Click to enlarge

CPTC-PRDX4-2 Western Blot

Western Blot using CPTC-PRDX4-2 as primary Ab against Ag 10604 (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).

Cell Lysate Western Blot

Click to enlarge image Western Blot using CPTC-PRDX4-2 as primary Ab against cell lysate from transiently overexpressed HEK293T cells form Origene (lane 3). Also included are molecular wt. standards (lane 1), lysate from non-transfected HEK293T cells as neg control (lane 4) and recombinant Ag PRDX4 (NCI 10604) in (lane 2).
Click to enlarge

CPTC-PRDX4-2 Cell Lysate Western blot

Western Blot using CPTC-PRDX4-2 as primary Ab against cell lysate from transiently overexpressed HEK293T cells form Origene (lane 3). Also included are molecular wt. standards (lane 1), lysate from non-transfected HEK293T cells as neg control (lane 4) and recombinant Ag PRDX4 (NCI 10604) in (lane 2).

Indirect ELISA

Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate)
Click to enlarge

CPTC-PRDX4-2 Indirect ELISA

Indirect ELISA (ie, binding of Antibody to Antigen coated plate)

NCI 60 Protein Array

Click to enlarge image Protein Array in which CPTC-PRDX4-2 is screened against the NCI60 cell line panel for expression. Data is normalized to a mean signal of 1.0 and standard deviation of 0.5. Color conveys over-expression level (green), basal level (blue), under-expression level (red).
Click to enlarge

CPTC-PRDX4-2 Protein Array

Protein Array in which CPTC-PRDX4-2 is screened against the NCI60 cell line panel for expression. Data is normalized to a mean signal of 1.0 and standard deviation of 0.5. Color conveys over-expression level (green), basal level (blue), under-expression level (red).

IHC NCI60

Click to enlarge image Immunohistochemistry of CPTC-PRDX4-2 for NCI60 Cell Line Array. Data scored as:
0=NEGATIVE
1=WEAK (red)
2=MODERATE (blue)
3=STRONG (green)
titer: 1:5000
Click to enlarge

CPTC-PRDX4-2 IHC NCI60

Immunohistochemistry of CPTC-PRDX4-2 for NCI60 Cell Line Array. Data scored as:
0=NEGATIVE
1=WEAK (red)
2=MODERATE (blue)
3=STRONG (green)
titer: 1:5000

Click to view IHC NCI60 Cell Line Array example

IHC Tissue

Click to enlarge image Tissue Micro-Array(TMA) core of colon cancer showing cytoplasmic staining using Antibody CPTC-PRDX4-2. Titer: 1:5000
Click to enlarge

CPTC-PRDX4-2 IHC Tissue

Tissue Micro-Array(TMA) core of colon cancer showing cytoplasmic staining using Antibody CPTC-PRDX4-2. Titer: 1:5000

IHC HPA

Download PRDX4-2 HPA Report.pdf (152.2 KB)

CPTC-PRDX4-2 evaluation by the Human Protein Atlas

This PDF provides the evaluation results as provided by the Human Protein Atlas (www.proteinatlas.org).

SPR

Click to enlarge image Kinetic titration data for PRDX4-2 Ab (632A14.1) using Biacore SPR method
Click to enlarge

CPTC-PRDX4-2 SPR

Kinetic titration data for PRDX4-2 Ab (632A14.1) using Biacore SPR method

Antibody: CPTC-PRDX4-3

Background

Catalog Number:
CPTC-PRDX4-3
Target Antigen:
Peroxiredoxin 4
Isotype:
IgG2a
Species:
Mouse
Last Updated:
03/07/2013
Antigen Recognition(s):

Purchase

Characterization Data [Compare Characterization Data]

Western Blot

Click to enlarge image Western Blot using CPTC-PRDX4-3 as primary Ab against Ag 10604 (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).
Click to enlarge

CPTC-PRDX4-3 Western Blot

Western Blot using CPTC-PRDX4-3 as primary Ab against Ag 10604 (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).

Cell Lysate Western Blot

Click to enlarge image Western Blot using CPTC-PRDX4-3 as primary Ab against cell lysate from transiently overexpressed HEK293T cells form Origene (lane 3). Also included are molecular wt. standards (lane 1), lysate from non-transfected HEK293T cells as neg control (lane 4) and recombinant Ag PRDX4 (NCI 10604) in (lane 2).
Click to enlarge

CPTC-PRDX4-3 Cell Lysate Western blot

Western Blot using CPTC-PRDX4-3 as primary Ab against cell lysate from transiently overexpressed HEK293T cells form Origene (lane 3). Also included are molecular wt. standards (lane 1), lysate from non-transfected HEK293T cells as neg control (lane 4) and recombinant Ag PRDX4 (NCI 10604) in (lane 2).

Indirect ELISA

Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate)
Click to enlarge

CPTC-PRDX4-3 Indirect ELISA

Indirect ELISA (ie, binding of Antibody to Antigen coated plate)

NCI 60 Protein Array

Click to enlarge image Protein Array in which CPTC-PRDX4-3 is screened against the NCI60 cell line panel for expression. Data is normalized to a mean signal of 1.0 and standard deviation of 0.5.
Click to enlarge

CPTC-PRDX4-3 NCI 60 Protein Array

Protein Array in which CPTC-PRDX4-3 is screened against the NCI60 cell line panel for expression. Data is normalized to a mean signal of 1.0 and standard deviation of 0.5.

IHC NCI60

CPTC-PRDX4-3 IHC NCI60

This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.

Click to view IHC NCI60 Cell Line Array example

IHC Tissue

CPTC-PRDX4-3 IHC Tissue

This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.

IHC HPA

Download CPTC-PRDX4-3.pdf (96.2 KB)

CPTC-PRDX4-3 Evaluation by Human Protein Atlas

This PDF contains the evaluation results provided by the Human Protein Atlas (www.proteinatlas.org)

Array
Antigen: Peroxiredoxin 4

Background

NCI Identification Number:
10604
Antigen Name:
Peroxiredoxin 4
CPTC Name:
CPTC-PRDX4
Keywords:
PRDX4; AOE37-2; EC 1.11.1.15; PRX-4; Prx-IV; OTTHUMP00000023056;
Function:
The protein encoded by this gene is an antioxidant enzyme and belongs to the peroxiredoxin family.
The protein is localized to the cytoplasm. Peroxidases of the peroxiredoxin family reduce hydrogen peroxide and alkyl hydroperoxides to water and alcohol with the use of reducing equivalents derived from thiol-containing donor molecules. This protein has been found to play a regulatory role in the activation of the transcription factor NF-kappaB.
Chromosomal Localization:
Xp22.11
Expression System:
E. Coli
NCBI Accession Number:
BC016770
Swiss Prot Accession Number:
Q13162
DNA Source:
HIP:HsCD00005539
Immunogen:
Recombinant Full Length Protein
Vector Name:
pMCSG7
Extinction Coefficient:
37025
Buffers:
50mM NH4HC03
Expressed Sequence:
SNAWETEERPRTREEECHFYAGGQVYPGEASRVSVADHSLHLSKAKIS
KPAPYWEGTAVIDGEFKELKLTDYRGKYLVFFFYPLDFTFVCPTEIIA
FGDRLEEFRSINTEVVACSVDSQFTHLAWINTPRRQGGLGPIRIPLLS
DLTHQISKDYGVYLEDSGHTLRGLFIIDDKGILRQITLNDLPVGRSVD
ETLRLVQAFQYTDKHGEVCPAGWKPGSETIIPDPAGKLKYFDKLN
Native Sequence:
MEALPLLAATTPDHGRHRRLLLLPLLLFLLPAGAVQGWETEERPRTREEECHFYA
GGQVYPGEASRVSVADHSLHLSKAKISKPAPYWEGTAVIDGEFKELKLTDYRGKY
LVFFFYPLDFTFVCPTEIIAFGDRLEEFRSINTEVVACSVDSQFTHLAWINTPRR
QGGLGPIRIPLLSDLTHQISKDYGVYLEDSGHTLRGLFIIDDKGILRQITLNDLP
VGRSVDETLRLVQAFQYTDKHGEVCPAGWKPGSETIIPDPAGKLKYFDKLN
Calculated Isoelectric Point:
5.53
Molecular Weight:
26844
Last Updated:
11/14/2012

Links

Characterization Data

Gel

Click to enlarge image Protein Array in which CPTC-PRDX4-3 is screened against the NCI60 cell line panel for expression. Data is normalized to a mean signal of 1.0 and standard deviation of 0.5.
Click to enlarge

Ag 10604

PAGE of Ag 10604 (with molecular weight standards in lane 1)

SOPs

Adobe Reader™ required.

Get Adobe Reader for free at Adobe.com