Skip to Content

Protein Phosphatase 2A

Antibody: CPTC-PP2A-1

Background

Catalog Number:
CPTC-PP2A-1
Target Antigen:
Protein Phosphatase 2A
Isotype:
IgG1
Species:
Mouse
Last Updated:
02/25/2013
Antigen Recognition(s):
recombinant full-length

Purchase

Characterization Data [Compare Characterization Data]

Western Blot

Click to enlarge image Western Blot using CPTC-PP2A-1 as primary Ab against Ag 10501 (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).
Click to enlarge

CPTC-PP2A-1 Western Blot

Western Blot using CPTC-PP2A-1 as primary Ab against Ag 10501 (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).

Indirect ELISA

Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate)
Click to enlarge

CPTC-PP2A-1 Indirect ELISA

Indirect ELISA (ie, binding of Antibody to Antigen coated plate)

NCI 60 Protein Array

CPTC-PP2A-1 NCI 60 Protein Array

This antibody is not suitable for use in a Reverse Phase Protein Array format as described in SOP M-105.

IHC NCI60

CPTC-PP2A-1 IHC NCI60

This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.

Click to view IHC NCI60 Cell Line Array example

IHC Tissue

CPTC-PP2A-1 IHC Tissue

This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.

SPR

Click to enlarge image Kinetic titration data for PP2A-1 Ab (622A1.1) using Biacore SPR method
Click to enlarge

CPTC-PP2A-1 SPR

Kinetic titration data for PP2A-1 Ab (622A1.1) using Biacore SPR method

Antibody: CPTC-PP2A-2

Background

Catalog Number:
CPTC-PP2A-2
Target Antigen:
Protein Phosphatase 2A
Isotype:
IgG1
Species:
Mouse
Last Updated:
01/24/2012
Antigen Recognition(s):
recombinant full-length

Purchase

Characterization Data [Compare Characterization Data]

Western Blot

Click to enlarge image Western Blot using CPTC-PP2A-2 as primary Ab against Ag 10501 (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).
Click to enlarge

CPTC-PP2A-2 Western Blot

Western Blot using CPTC-PP2A-2 as primary Ab against Ag 10501 (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).

Indirect ELISA

Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate)
Click to enlarge

CPTC-PP2A-2 Indirect ELISA

Indirect ELISA (ie, binding of Antibody to Antigen coated plate)

SPR

Click to enlarge image Kinetic titration data for PP2A-2 Ab (622A3.1) using Biacore SPR method
Click to enlarge

CPTC-PP2A-2 SPR

Kinetic titration data for PP2A-2 Ab (622A3.1) using Biacore SPR method

Antibody: CPTC-PP2A-3

Background

Catalog Number:
CPTC-PP2A-3
Target Antigen:
Protein Phosphatase 2A
Isotype:
IgG2a
Species:
Mouse
Last Updated:
01/26/2012
Antigen Recognition(s):
recombinant full-length

Purchase

Characterization Data [Compare Characterization Data]

Western Blot

Click to enlarge image Western Blot using CPTC-PP2A-3 as primary Ab against Ag 10501 (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).
Click to enlarge

CPTC-PP2A-3 Western Blot

Western Blot using CPTC-PP2A-3 as primary Ab against Ag 10501 (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).

Indirect ELISA

Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate)
Click to enlarge

CPTC-PP2A-3 Indirect ELISA

Indirect ELISA (ie, binding of Antibody to Antigen coated plate)

NCI 60 Protein Array

Click to enlarge image Protein Array in which CPTC-PP2A-3 is screened against the NCI60 cell line panel for expression. Data is normalized to a mean signal of 1.0 and standard deviation of 0.5. Color conveys over-expression level (green), basal level (blue), under-expression level (red).
Click to enlarge

CPTC-PP2A-3 Protein Array

Protein Array in which CPTC-PP2A-3 is screened against the NCI60 cell line panel for expression. Data is normalized to a mean signal of 1.0 and standard deviation of 0.5. Color conveys over-expression level (green), basal level (blue), under-expression level (red).

Antibody: CPTC-PP2A-4

Background

Catalog Number:
CPTC-PP2A-4
Target Antigen:
Protein Phosphatase 2A
Isotype:
IgG1
Species:
Mouse
Last Updated:
01/26/2012
Antigen Recognition(s):
recombinant full-length

Purchase

Characterization Data [Compare Characterization Data]

Western Blot

Click to enlarge image Western Blot using CPTC-PP2A-4 as primary Ab against Ag 10501 (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).
Click to enlarge

CPTC-PP2A-4 Western Blot

Western Blot using CPTC-PP2A-4 as primary Ab against Ag 10501 (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).

Indirect ELISA

Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate)
Click to enlarge

CPTC-PP2A-4 Indirect ELISA

Indirect ELISA (ie, binding of Antibody to Antigen coated plate)

Antigen: Protein Phosphatase 2A

Background

NCI Identification Number:
10501
Antigen Name:
Protein Phosphatase 2A
CPTC Name:
CPTC-PP2A
Keywords:
PP2A; PPP2CA; EC3.1.3.16; PP2A-alpha; PP2Ac; PP2CA; RP-C
Function:
PP2A can modulate the activity of phosphorylase B kinase casein kinase 2, mitogen-stimulated S6 kinase, and MAP-2 kinase. Can dephosphorylate SV40 large T antigen and p53.
Dephosphorylates SV40 large T antigen, preferentially on serine residues 120, 123, 677, and perhaps 679. The C subunit was most active, followed by the AC form, which was more active than
the ABC form, and activity of all three forms was strongly stimulated by manganese, and to a lesser extent by magnesium. Dephosphorylation by the AC form, but not C or ABC form is inhibited by small T antigen
Chromosomal Localization:
5q31.1
Expression System:
E. Coli
NCBI Accession Number:
BC011605
Swiss Prot Accession Number:
Q15257
DNA Source:
HIP:HsCD00004559
Immunogen:
Recombinant Full Length Protein
Vector Name:
pMCSG7
Extinction Coefficient:
56505
Buffers:
50mM NH4HC03
Expressed Sequence:
SNAMAEGERQPPPDSSEEAPPATQNFIIPKKEIHTVPDMGKWKRSQAYADYIGFI
LTLNEGVKGKKLTFEYRVSEAIEKLVALLNTLDRWIDETPPVDQPSRFGNKAYRT
WYAKLDEEAENLVATVVPTHLAAAVPEVAVYLKESVGNSTRIDYGTGHEAAFAAF
LCCLCKIGVLRVDDQIAIVFKVFNRYLEVMRKLQKTYRMEPAGSQGVWGLDDFQF
LPFIWGSSQLIDHPYLEPRHFVDEKAVNENHKDYMFLECILFITEMKTGPFAEHS
NQLWNISAVPSWSKVNQGLIRMYKAECLEKFPVIQHFKFGSLLPIHPVTSG
Native Sequence:
MAEGERQPPPDSSEEAPPATQNFIIPKKEIHTVPDMGKWKRSQAYADYIGFILT
LNEGVKGKKLTFEYRVSEAIEKLVALLNTLDRWIDETPPVDQPSRFGNKAYRTW
YAKLDEEAENLVATVVPTHLAAAVPEVAVYLKESVGNSTRIDYGTGHEAAFAAF
LCCLCKIGVLRVDDQIAIVFKVFNRYLEVMRKLQKTYRMEPAGSQGVWGLDDFQ
FLPFIWGSSQLIDHPYLEPRHFVDEKAVNENHKDYMFLECILFITEMKTGPFAE
HSNQLWNISAVPSWSKVNQGLIRMYKAECLEKFPVIQHFKFGSLLPIHPVTSG
Calculated Isoelectric Point:
5.89
Molecular Weight:
37047
Last Updated:
11/14/2012

Links

Characterization Data

Gel

Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate)
Click to enlarge

CPTC-PP2A (Ag 10501) PAGE

PAGE of Ag 10501 with molecular weight standards in lane 1

SOPs

Adobe Reader™ required.

Get Adobe Reader for free at Adobe.com