Skip to Content

Phenylethanolamine N-methyltransferase

Antibody: CPTC-PNMT-1

Background

Catalog Number:
CPTC-PNMT-1
Target Antigen:
Phenylethanolamine N-methyltransferase
Isotype:
IgG2a
Species:
Mouse
Last Updated:
02/26/2013
Antigen Recognition(s):
recombinant full-length

Purchase

Characterization Data [Compare Characterization Data]

Western Blot

Click to enlarge image Western Blot using CPTC-PNMT-1 as primary Ab against PNMT (rAg 10900) in lane 2. Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).
Click to enlarge

CPTC-PNMT-1 Western blot

Western Blot using CPTC-PNMT-1 as primary Ab against PNMT (rAg 10900) in lane 2. Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).

Indirect ELISA

Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding.
Click to enlarge

CPTC-PNMT-1 Indirect ELISA

Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding.

NCI 60 Protein Array

CPTC-PNMT-1 NCI 60 Protein Array

This antibody is not suitable for use in a Reverse Phase Protein Array format as described in SOP M-105.

IHC NCI60

CPTC-PNMT-1 IHC NCI60

This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.

Click to view IHC NCI60 Cell Line Array example

IHC Tissue

CPTC-PNMT-1 IHC Tissue

This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.

Antibody: CPTC-PNMT-2

Background

Catalog Number:
CPTC-PNMT-2
Target Antigen:
Phenylethanolamine N-methyltransferase
Isotype:
IgG2a
Species:
Mouse
Last Updated:
02/26/2013
Antigen Recognition(s):
recombinant full-length

Purchase

Characterization Data [Compare Characterization Data]

Western Blot

Click to enlarge image Western Blot using CPTC-PNMT-2 as primary Ab against PNMT (rAg 10900) in lane 2. Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).
Click to enlarge

CPTC-PNMT-2 Western blot

Western Blot using CPTC-PNMT-2 as primary Ab against PNMT (rAg 10900) in lane 2. Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).

Indirect ELISA

Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding.
Click to enlarge

CPTC-PNMT-2 Indirect ELISA

Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding.

NCI 60 Protein Array

CPTC-PNMT-2 NCI 60 Protein Array

This antibody is not suitable for use in a Reverse Phase Protein Array format as described in SOP M-105.

IHC NCI60

CPTC-PNMT-2 IHC NCI60

This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.

Click to view IHC NCI60 Cell Line Array example

IHC Tissue

CPTC-PNMT-2 IHC Tissue

This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.

Antibody: CPTC-PNMT-3

Background

Catalog Number:
CPTC-PNMT-3
Target Antigen:
Phenylethanolamine N-methyltransferase
Isotype:
IgG2b
Species:
Mouse
Last Updated:
02/26/2013
Antigen Recognition(s):
recombinant full-length

Purchase

Characterization Data [Compare Characterization Data]

Western Blot

Click to enlarge image Western Blot using CPTC-PNMT-2 as primary Ab against PNMT (rAg 10900) in lane 2. Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).
Click to enlarge

CPTC-PNMT-3 Western blot

Western Blot using CPTC-PNMT-2 as primary Ab against PNMT (rAg 10900) in lane 2. Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).

Indirect ELISA

Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding.
Click to enlarge

CPTC-PNMT-3 Indirect ELISA

Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding.

NCI 60 Protein Array

CPTC-PNMT-3 NCI 60 Protein Array

This antibody is not suitable for use in a Reverse Phase Protein Array format as described in SOP M-105.

IHC NCI60

CPTC-PNMT-3 IHC NCI60

This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.

Click to view IHC NCI60 Cell Line Array example

IHC Tissue

CPTC-PNMT-3 IHC Tissue

This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.

Antigen: Phenylethanolamine N-methyltransferase

Background

NCI Identification Number:
10900
Antigen Name:
Phenylethanolamine N-methyltransferase
CPTC Name:
CPTC-PNMT
Keywords:
EC 2.1.1.28; MGC34570; OTTHUMP00000164271; PENT; PNMTase
Function:
The product of this gene catalyzes the last step of the catecholamine biosynthesis pathway, which methylates norepinephrine to form epinephrine (adrenaline). The enzyme also has beta-carboline 2N-methyltransferase activity. This gene is thought to play a key step in regulating epinephrine production.

Converts noradrenaline to adrenaline.
Chromosomal Localization:
17q21 - q22
Expression System:
E. Coli
NCBI Accession Number:
BC037246.1
Swiss Prot Accession Number:
P11086
DNA Source:
OB : MHS1010-7507627
Immunogen:
Recombinant Full Length Protein
Vector Name:
pMCSG7
Extinction Coefficient:
45108
Buffers:
PBS
Expressed Sequence:
SNAMSGADRSPNAGAAPDSAPGQAAVASAYQRFEPRAYLRNNYAPPRGDLCNPNGVG
PWKLRCLAQTFATGEVSGRTLIDIGSGPTVYQLLSACSHFEDITMTDFLEVNRQELG
RWLQEEPGAFNWSMYSQHACLIEGKGECWQDKERQLRARVKRVLPIDVHQPQPLGAG
SPAPLPADALVSAFCLEAVSPDLASFQRALDHITTLLRPGGHLLLIGALEESWYLAG
EARLTVVPVSEEEVREALVRSGYKVRDLRTYIMPAHLQTGVDDVKGVFFAWAQKVGL
Native Sequence:
MSGADRSPNAGAAPDSAPGQAAVASAYQRFEPRAYLRNNYAPPRGDLCNPNGVGPWK
LRCLAQTFATGEVSGRTLIDIGSGPTVYQLLSACSHFEDITMTDFLEVNRQELGRWL
QEEPGAFNWSMYSQHACLIEGKGECWQDKERQLRARVKRVLPIDVHQPQPLGAGSPA
PLPADALVSAFCLEAVSPDLASFQRALDHITTLLRPGGHLLLIGALEESWYLAGEAR
LTVVPVSEEEVREALVRSGYKVRDLRTYIMPAHLQTGVDDVKGVFFAWAQKVGL
Calculated Isoelectric Point:
5.73
Molecular Weight:
30.86
Last Updated:
11/14/2012

Links

Characterization Data

Gel

Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding.
Click to enlarge

CPTC-PNMT PAGE

PAGE of Ag 10900(with molecular weight standards in lane 1)

SOPs

Adobe Reader™ required.

Get Adobe Reader for free at Adobe.com