Skip to Content

Phosphatidylethanolamine Binding Protein 1

Antibody: CPTC-PEBP1-1

Background

Catalog Number:
CPTC-PEBP1-1
Target Antigen:
Phosphatidylethanolamine Binding Protein 1
Isotype:
IgG1
Species:
Mouse
Last Updated:
12/19/2013
Antigen Recognition(s):

Characterization Data [Compare Characterization Data]

Western Blot

CPTC-PEBP1-1 Western blot

This antibody is not suitable for use in Western blots

Characterization SOP Files

Indirect ELISA

Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding.
Click to enlarge

CPTC-PEBP1-1 Indirect ELISA

Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding.

Antibody: CPTC-PEBP1-2

Background

Catalog Number:
CPTC-PEBP1-2
Target Antigen:
Phosphatidylethanolamine Binding Protein 1
Isotype:
IgG2b
Species:
Mouse
Last Updated:
05/22/2014
Antigen Recognition(s):

Purchase

Characterization Data [Compare Characterization Data]

Western Blot

Click to enlarge image Western Blot using CPTC-PEBP1-2 as primary Ab against PEBP1 (rAg 00060) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).
Click to enlarge

CPTC-PEBP1-2 Western blot

Western Blot using CPTC-PEBP1-2 as primary Ab against PEBP1 (rAg 00060) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).

Indirect ELISA

Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding.
Click to enlarge

CPTC-PEBP1-2 Indirect ELISA

Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding.

NCI 60 Protein Array

CPTC-PEBP1-2 NCI 60 Protein Array

This antibody is not suitable for use in a Reverse Phase Protein Array format as described in SOP M-105.

Antigen: Phosphatidylethanolamine Binding Protein 1

Background

NCI Identification Number:
00060
Antigen Name:
Phosphatidylethanolamine Binding Protein 1
CPTC Name:
CPTC-PEBP1
Keywords:
PBP; RKIP; PEBP; HCNP; Prostatic Binding Protein; Neuropolypeptide H3; Prostatic-Binding Protein; Raf Kinase Inhibitor Protein; HCNPpp; PEBP-1; Hippocampal Cholinergic Neurostimulating Peptide; Phosphatidylethanolamine-Binding Protein 1; Raf Kinase Inhibitory Protein
Function:
Binds ATP, opioids and phosphatidylethanolamine. Has lower affinity for phosphatidylinositol and phosphatidylcholine. Serine protease inhibitor which inhibits thrombin, neuropsin and chymotrypsin but not trypsin, tissue type plasminogen activator and elastase (By similarity). Inhibits the kinase activity of RAF1 by inhibiting its activation and by dissociating the RAF1/MEK complex and acting as a competitive inhibitor of MEK phosphorylation

Function: HCNP may be involved in the function of the presynaptic cholinergic neurons of the central nervous system. HCNP increases the production of choline acetyltransferase but not acetylcholinesterase. Seems to be mediated by a specific receptor.
Chromosomal Localization:
12q24.23
Expression System:
Baculovirus
NCBI Accession Number:
NP_002558.1
Swiss Prot Accession Number:
P30086
DNA Source:
human ORFeome library
Immunogen:
Recombinant Full Length Protein
Vector Name:
11725-X06-635
Extinction Coefficient:
Buffers:
1x PBS, pH 7.2
Expressed Sequence:
MGSGSHHHHHHRSSITSLYKKVGENLYFQGPVDLSKWSGPLSLQE
VDEQPQHPLHVTYAGAAVDELGKVLTPTQVKNRPTSISWDGLDSG
KLYTLVLTDPDAPSRKDPKYREWHHFLVVNMKGNDISSGTVLSDY
VGSGPPKGTGLHRYVWLVYEQDRPLKCDEPILSNRSGDHRGKFKV
ASFRKKYELRAPVAGTCYQAEWDDYVPKLYEQLSGKHHHHHH
Native Sequence:
Calculated Isoelectric Point:
0
Molecular Weight:
25163
Last Updated:
11/13/2013

Links

Characterization Data

Gel

Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding.
Click to enlarge

CPTC-PEBP1 PAGE

PAGE of PEBP1 (rAg 00060) with molecular weight standards in lane 1

SOPs

Adobe Reader™ required.

Get Adobe Reader for free at Adobe.com