Skip to Content

PDZ and LIM Domain 1

Antibody: CPTC-PDLIM1-1

Background

Catalog Number:
CPTC-PDLIM1-1
Target Antigen:
PDZ and LIM Domain 1
Isotype:
IgG1
Species:
Mouse
Last Updated:
02/26/2013
Antigen Recognition(s):
recombinant full-length

Purchase

Characterization Data [Compare Characterization Data]

Western Blot

Click to enlarge image Western Blot using CPTC-PDLIM1-1 as primary Ab against PDLIM1 (rAg 10044) in lane 2. Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).
Click to enlarge

CPTC-PDLIM1-1 Western blot

Western Blot using CPTC-PDLIM1-1 as primary Ab against PDLIM1 (rAg 10044) in lane 2. Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).

Cell Lysate Western Blot

Click to enlarge image Western Blot using CPTC-PDLIM1-1 as primary Ab against cell lysate from transiently overexpressed HEK293T cells form Origene (lane 3). Also included are molecular wt. standards (lane 1), lysate from non-transfected HEK293T cells as neg control (lane 4) and recombinant Ag PDLIM1 (NCI 10044) in (lane 2).
Click to enlarge

CPTC-PDLIM1-1 Cell Lysate blot

Western Blot using CPTC-PDLIM1-1 as primary Ab against cell lysate from transiently overexpressed HEK293T cells form Origene (lane 3). Also included are molecular wt. standards (lane 1), lysate from non-transfected HEK293T cells as neg control (lane 4) and recombinant Ag PDLIM1 (NCI 10044) in (lane 2).

Indirect ELISA

Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding.
Click to enlarge

CPTC-PDLIM1-1 Indirect ELISA

Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding.

NCI 60 Protein Array

CPTC-PDLIM1-1 NCI 60 Protein Array

This antibody is not suitable for use in a Reverse Phase Protein Array format as described in SOP M-105.

IHC NCI60

CPTC-PDLIM1-1 IHC NCI60

This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.

Click to view IHC NCI60 Cell Line Array example

IHC Tissue

CPTC-PDLIM1-1 IHC Tissue

This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.

SPR

Download PDLIM1 pairing.pdf (792.1 KB)

SPR pairing results

These are the results of SPR pairing experiments with PDLIM1 antibodies.

Antibody: CPTC-PDLIM1-2

Background

Catalog Number:
CPTC-PDLIM1-2
Target Antigen:
PDZ and LIM Domain 1
Isotype:
IgG1
Species:
Mouse
Last Updated:
06/12/2014
Antigen Recognition(s):

Purchase

Characterization Data [Compare Characterization Data]

Western Blot

Click to enlarge image Western Blot using CPTC-PDLIM1-2 as primary Ab against PDLIM1 (rAg 10044) in lane 2. Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).
Click to enlarge

CPTC-PDLIM1-2 Western blot

Western Blot using CPTC-PDLIM1-2 as primary Ab against PDLIM1 (rAg 10044) in lane 2. Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).

Cell Lysate Western Blot

Click to enlarge image Western Blot using CPTC-PDLIM1-2 as primary Ab against cell lysate from transiently overexpressed HEK293T cells form Origene (lane 3). Also included are molecular wt. standards (lane 1), lysate from non-transfected HEK293T cells as neg control (lane 4) and recombinant Ag PDLIM1 (NCI 10044) in (lane 2).
Click to enlarge

CPTC-PDLIM1-2 Cell Lysate blot

Western Blot using CPTC-PDLIM1-2 as primary Ab against cell lysate from transiently overexpressed HEK293T cells form Origene (lane 3). Also included are molecular wt. standards (lane 1), lysate from non-transfected HEK293T cells as neg control (lane 4) and recombinant Ag PDLIM1 (NCI 10044) in (lane 2).

Indirect ELISA

Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding.
Click to enlarge

CPTC-PDLIM1-2 Indirect ELISA

Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding.

NCI 60 Protein Array

Click to enlarge image Protein Array in which CPTC-PDLIM1-2 is screened against the NCI60 cell line panel for expression. Data is normalized to a mean signal of 1.0 and standard deviation of 0.5. Color conveys over-expression level (green), basal level (blue), under-expression level (red).
Click to enlarge

CPTC-PDLIM1-2 NCI 60 Protein Array

Protein Array in which CPTC-PDLIM1-2 is screened against the NCI60 cell line panel for expression. Data is normalized to a mean signal of 1.0 and standard deviation of 0.5. Color conveys over-expression level (green), basal level (blue), under-expression level (red).

SPR

Download PDLIM1 pairing.pdf (792.1 KB)

SPR pairing results

These are the results of SPR pairing experiments with PDLIM1 antibodies.

Antibody: CPTC-PDLIM1-3

Background

Catalog Number:
CPTC-PDLIM1-3
Target Antigen:
PDZ and LIM Domain 1
Isotype:
IgG1
Species:
Mouse
Last Updated:
02/26/2013
Antigen Recognition(s):
recombinant full-length

Purchase

Characterization Data [Compare Characterization Data]

Western Blot

Click to enlarge image Western Blot using CPTC-PDLIM1-3 as primary Ab against PDLIM1 (rAg 10044) in lane 2. Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).
Click to enlarge

CPTC-PDLIM1-3 Western blot

Western Blot using CPTC-PDLIM1-3 as primary Ab against PDLIM1 (rAg 10044) in lane 2. Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).

Cell Lysate Western Blot

Click to enlarge image Western Blot using CPTC-PDLIM1-3 as primary Ab against cell lysate from transiently overexpressed HEK293T cells form Origene (lane 3). Also included are molecular wt. standards (lane 1), lysate from non-transfected HEK293T cells as neg control (lane 4) and recombinant Ag PDLIM1 (NCI 10044) in (lane 2).
Click to enlarge

CPTC-PDLIM1-3 Cell Lysate blot

Western Blot using CPTC-PDLIM1-3 as primary Ab against cell lysate from transiently overexpressed HEK293T cells form Origene (lane 3). Also included are molecular wt. standards (lane 1), lysate from non-transfected HEK293T cells as neg control (lane 4) and recombinant Ag PDLIM1 (NCI 10044) in (lane 2).

Indirect ELISA

Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding.
Click to enlarge

CPTC-PDLIM1-3 Indirect ELISA

Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding.

NCI 60 Protein Array

CPTC-PDLIM1-3 NCI 60 Protein Array

This antibody is not suitable for use in a Reverse Phase Protein Array format as described in SOP M-105.

IHC NCI60

CPTC-PDLIM1-3 IHC NCI60

This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.

Click to view IHC NCI60 Cell Line Array example

IHC Tissue

CPTC-PDLIM1-3 IHC Tissue

This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.

SPR

Download PDLIM1 pairing.pdf (792.1 KB)

SPR pairing results

These are the results of SPR pairing experiments with PDLIM1 antibodies.

Antigen: PDZ and LIM Domain 1

Background

NCI Identification Number:
10044
Antigen Name:
PDZ and LIM Domain 1
CPTC Name:
CPTC-PDLIM1
Keywords:
PDZ and LIM domain 1; CLP36; CLIM1; hCLIM1; CLP-36; C-terminal LIM domain protein 1; LIM domain protein CLP-36
Function:
Cytoskeletal protein that may act as an adapter that brings other proteins (like kinases) to the cytoskeleton
Chromosomal Localization:
10q23.1
Expression System:
E. Coli
NCBI Accession Number:
BC000915.1
Swiss Prot Accession Number:
O00151
DNA Source:
Invitrogen - 2985229
Immunogen:
Recombinant Full Length Protein
Vector Name:
pMCSG7
Extinction Coefficient:
21430
Buffers:
PBS without Ca++ and Mg++
Expressed Sequence:
SNAMTTQQIDLQGPGPWGFRLVGGKDFEQPLAISRVTPGSKAALANLCIGDVITAI
DGENTSNMTHLEAQNRIKGCTDNLTLTVARSEHKVWSPLVTEEGKRHPYKMNLASE
PQEVLHIGSAHNRSAMPFTASPASSTTARVITNQYNNPAGLYSSENISNFNNALES
KTAASGVEANSRPLDHAQPPSSLVIDKESEVYKMLQEKQELNEPPKQSTSFLVLQE
ILESEEKGDPNKPSGFRSVKAPVTKVAASIGNAQKLPMCDKCGTGIVGVFVKLRDR
HRHPECYVCTDCGTNLKQKGHFFVEDQIYCEKHARERVTPPEGYEVVTVFPK
Native Sequence:
MTTQQIDLQGPGPWGFRLVGGKDFEQPLAISRVTPGSKAALANLCIGDVITAIDG
ENTSNMTHLEAQNRIKGCTDNLTLTVARSEHKVWSPLVTEEGKRHPYKMNLASEP
QEVLHIGSAHNRSAMPFTASPASSTTARVITNQYNNPAGLYSSENISNFNNALES
KTAASGVEANSRPLDHAQPPSSLVIDKESEVYKMLQEKQELNEPPKQSTSFLVLQ
EILESEEKGDPNKPSGFRSVKAPVTKVAASIGNAQKLPMCDKCGTGIVGVFVKLR
DRHRHPECYVCTDCGTNLKQKGHFFVEDQIYCEKHARERVTPPEGYEVVTVFPK
Calculated Isoelectric Point:
6.56
Molecular Weight:
36072
Last Updated:
11/14/2012

Links

Characterization Data

Gel

Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding.
Click to enlarge

CPTC-PDLIM1 PAGE

PAGE of PDLIM1 (rAg 10044) with molecular weight standards in lane 1

SOPs

Adobe Reader™ required.

Get Adobe Reader for free at Adobe.com