Skip to Content

OTU domain, ubiquitin aldehyde binding 2

Antibody: CPTC-OTUB2-1

Background

Catalog Number:
CPTC-OTUB2-1
Target Antigen:
OTU domain, ubiquitin aldehyde binding 2
Isotype:
IgG2a
Species:
Mouse
Last Updated:
06/12/2014
Antigen Recognition(s):

Characterization Data [Compare Characterization Data]

Western Blot

Click to enlarge image Western Blot using CPTC-OTUB2-1 as primary Ab against PEBP1 (rAg 00054) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).
Click to enlarge

CPTC-OTUB2-1 Western blot

Western Blot using CPTC-OTUB2-1 as primary Ab against PEBP1 (rAg 00054) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).

Indirect ELISA

Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding.
Click to enlarge

CPTC-OTUB2-1 Indirect ELISA

Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding.

NCI 60 Protein Array

CPTC-OTUB2-1 NCI 60 Protein Array

This antibody is not suitable for use in a Reverse Phase Protein Array format as described in SOP M-105.

Antibody: CPTC-OTUB2-2

Background

Catalog Number:
CPTC-OTUB2-2
Target Antigen:
OTU domain, ubiquitin aldehyde binding 2
Isotype:
IgG2a
Species:
Mouse
Last Updated:
06/12/2014
Antigen Recognition(s):

Characterization Data [Compare Characterization Data]

Western Blot

Click to enlarge image Western Blot using CPTC-OTUB2-2 as primary Ab against PEBP1 (rAg 00054) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).
Click to enlarge

CPTC-OTUB2-2 Western blot

Western Blot using CPTC-OTUB2-2 as primary Ab against PEBP1 (rAg 00054) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).

Indirect ELISA

Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding.
Click to enlarge

CPTC-OTUB2-2 Indirect ELISA

Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding.

NCI 60 Protein Array

CPTC-OTUB2-2 NCI 60 Protein Array

This antibody is not suitable for use in a Reverse Phase Protein Array format as described in SOP M-105.

Antigen: OTU domain, ubiquitin aldehyde binding 2

Background

NCI Identification Number:
00054
Antigen Name:
OTU domain, ubiquitin aldehyde binding 2
CPTC Name:
CPTC-OTUB2
Keywords:
C14orf137; OTB2; OTU2; Deubiquitinating Enzyme OTUB2; Ubiquitin-Specific-Processing Protease OTUB2; OTU Domain-Containing Ubiquitin Aldehyde-Binding Protein 2; FLJ21916; MGC3102; Chromosome 14 Open Reading Frame 137; Otubain-2; Ubiquitin Thioesterase OTUB2; Ubiquitin-Specific Protease Otubain 2; EC 3.4.19.12; Otubain-2
Function:
This gene encodes one of several deubiquitylating enzymes. Ubiquitin modification of proteins is needed for their stability and function; to reverse the process, deubiquityling enzymes remove ubiquitin. This protein contains an OTU domain and binds Ubal (ubiquitin aldehyde); an active cysteine protease site is present in the OTU domain.

Hydrolase that can remove conjugated ubiquitin from proteins in vitro and may therefore play an important regulatory role at the level of protein turnover by preventing degradation. Mediates deubiquitination of both 'Lys-48'- and 'Lys-63'-linked polyubiquitin chains, with a preference for 'Lys-63'-linked polyubiquitin chains.
Chromosomal Localization:
14q32.12
Expression System:
E.coli
NCBI Accession Number:
NM_023112
Swiss Prot Accession Number:
Q96DC9
DNA Source:
Imagenes
Immunogen:
Native Protein
Vector Name:
pNIC28-Bsa4
Extinction Coefficient:
Buffers:
NaP
Expressed Sequence:
MHHHHHHSSGVDLGTENLYFQSMETSFNLISEKCDILSILRDHPENRIYRR
KIEELSKRFTAIRKTKGDGNCFYRALGYSYLESLLGKSREIFKFKERVLQT
PNDLLAAGFEEHKFRNFFNAFYSVVELVEKDGSVSSLLKVFNDQSASDHIV
QFLRLLTSAFIRNRADFFRHFIDEEMDIKDFCTHEVEPMATECDHIQITAL
SQALSIALQVEYVDEMDTALNHHVFPEAATPSVYLLYKTSHYNILYAADKH
Native Sequence:
Calculated Isoelectric Point:
0
Molecular Weight:
29679
Last Updated:
10/25/2013

Links

Characterization Data

Gel

Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding.
Click to enlarge

CPTC-OTUB2 PAGE

PAGE of OTUB2 (rAg 00054) with molecular weight standards in lane 1

SOPs

Adobe Reader™ required.

Get Adobe Reader for free at Adobe.com