Skip to Content

OTU domain, ubiquitin aldehyde binding 1

Antibody: CPTC-OTUB1-1

Background

Catalog Number:
CPTC-OTUB1-1
Target Antigen:
OTU domain, ubiquitin aldehyde binding 1
Isotype:
IgG1
Species:
Mouse
Last Updated:
06/11/2013
Antigen Recognition(s):

Characterization Data [Compare Characterization Data]

Western Blot

Click to enlarge image Western Blot using CPTC-OTUB1-1 as primary Ab against OTUB1 (rAg 00017) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).
Click to enlarge

CPTC-OTUB1-1 Western blot

Western Blot using CPTC-OTUB1-1 as primary Ab against OTUB1 (rAg 00017) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).

Indirect ELISA

Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding.
Click to enlarge

CPTC-OTUB1-1 Indirect ELISA

Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding.

Characterization SOP Files

Antibody: CPTC-OTUB1-2

Background

Catalog Number:
CPTC-OTUB1-2
Target Antigen:
OTU domain, ubiquitin aldehyde binding 1
Isotype:
IgG1
Species:
Mouse
Last Updated:
06/11/2013
Antigen Recognition(s):

Characterization Data [Compare Characterization Data]

Western Blot

Click to enlarge image Western Blot using CPTC-OTUB1-2 as primary Ab against OTUB1 (rAg 00017) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).
Click to enlarge

CPTC-OTUB1-2 Western blot

Western Blot using CPTC-OTUB1-2 as primary Ab against OTUB1 (rAg 00017) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).

Indirect ELISA

Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding.
Click to enlarge

CPTC-OTUB1-2 Indirect ELISA

Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding.

Characterization SOP Files

Antibody: CPTC-OTUB1-3

Background

Catalog Number:
CPTC-OTUB1-3
Target Antigen:
OTU domain, ubiquitin aldehyde binding 1
Isotype:
IgG2a
Species:
Mouse
Last Updated:
06/11/2013
Antigen Recognition(s):

Characterization Data [Compare Characterization Data]

Western Blot

Click to enlarge image Western Blot using CPTC-OTUB1-3 as primary Ab against OTUB1 (rAg 00017) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).
Click to enlarge

CPTC-OTUB1-3 Western blot

Western Blot using CPTC-OTUB1-3 as primary Ab against OTUB1 (rAg 00017) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).

Indirect ELISA

Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding.
Click to enlarge

CPTC-OTUB1-3 Indirect ELISA

Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding.

Characterization SOP Files

Antigen: OTU domain, ubiquitin aldehyde binding 1

Background

NCI Identification Number:
00017
Antigen Name:
OTU domain, ubiquitin aldehyde binding 1
CPTC Name:
CPTC-OTUB1
Keywords:
OTB1; OTU1; Deubiquitinating Enzyme OTUB1; Ubiquitin-Specific-Processing Protease OTUB1; OTU Domain-Containing Ubiquitin Aldehyde-Binding; FLJ20113; FLJ40710; Protein 1; OTU-Domain Ubal-Binding 1; Otubain-1; Ubiquitin Thioesterase OTUB1; Ubiquitin specific protease; EC 3.4.19.12; HOTU1; EC 3.1.2
Function:
The product of this gene is a member of the OTU (ovarian tumor) superfamily of predicted cysteine proteases. The encoded protein is a highly specific ubiquitin iso-peptidase, and cleaves ubiquitin from branched poly-ubiquitin chains but not from ubiquitinated substrates. It interacts with another ubiquitin protease and an E3 ubiquitin ligase that inhibits cytokine gene transcription in the immune system. It is proposed to function in specific ubiquitin-dependent pathways, possibly by providing an editing function for polyubiquitin chain growth. Alternative splicing results in multiple transcript variants.

Hydrolase that can specifically remove 'Lys-48'-linked conjugated ubiquitin from proteins and plays an important regulatory role at the level of protein turnover by preventing degradation. Regulator of T-cell anergy, a phenomenon that occurs when T-cells are rendered unresponsive to antigen rechallenge and no longer respond to their cognate antigen. Acts via its interaction with RNF128/GRAIL, a crucial inductor of CD4 T-cell anergy. Isoform 1 destabilizes RNF128, leading to prevent anergy. In contrast, isoform 2 stabilizes RNF128 and promotes anergy.
Surprisingly, it regulates RNF128-mediated ubiquitination, but does not deubiquitinate polyubiquitinated RNF128. Deubiquitinates estrogen receptor alpha (ESR1). Mediates deubiquitination of 'Lys-48'-linked polyubiquitin chains, but not 'Lys-63'-linked polyubiquitin chains. Not able to cleave di-ubiquitin. Also capable of removing NEDD8 from NEDD8 conjugates, but with a much lower preference compared to 'Lys-48'-linked ubiquitin.

Plays a key non-catalytic role in DNA repair regulation by inhibiting activity of RNF168, an E3 ubiquitin-protein ligase that promotes accumulation of 'Lys-63'-linked histone H2A and H2AX at DNA damage sites. Inhibits RNF168 independently of ubiquitin thioesterase activity by binding and inhibiting UBE2N/UBC13, the E2 partner of RNF168, thereby limiting spreading of 'Lys-63'-linked histone H2A and H2AX marks. Inhibition occurs by binding to free ubiquitin: free ubiquitin acts as an allosteric regulator that increases affinity for UBE2N/UBC13 and disrupts interaction with UBE2V1. The OTUB1-UBE2N/UBC13-free ubiquitin complex adopts a configuration that mimics a cleaved 'Lys48'-linked di-ubiquitin chain.
Chromosomal Localization:
11q13.1
Expression System:
E.coli
NCBI Accession Number:
NP_060140.2
Swiss Prot Accession Number:
Q96FW1
DNA Source:
Imagenes
Immunogen:
Recombinant Full Length Protein
Vector Name:
pNIC28-Bsa4
Extinction Coefficient:
Buffers:
NaP
Expressed Sequence:
MHHHHHHSSGVDLGTENLYFQSMMAAEEPQQQKQEPLGSDSEGVNCLAYDEAIMAQQDR
IQQEIAVQNPLVSERLELSVLYKEYAEDDNIYQQKIKDLHKKYSYIRKTRPDGNCFYRA
FGFSHLEALLDDSKELQRFKAVSAKSKEDLVSQGFTEFTIEDFHNTFMDLIEQVEKQTS
VADLLASFNDQSTSDYLVVYLRLLTSGYLQRESKFFEHFIEGGRTVKEFCQQEVEPMCK
ESDHIHIIALAQALSVSIQVEYMDRGEGGTTNPHIFPEGSEPKVYLLYRPGHYDILYK
Native Sequence:
Calculated Isoelectric Point:
0
Molecular Weight:
33968
Last Updated:
06/11/2013

Links

Characterization Data

Gel

Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding.
Click to enlarge

CPTC-OTUB1 PAGE

PAGE of OTUB1 (rAg 00017) with molecular weight standards in lane 1.

SOPs

Adobe Reader™ required.

Get Adobe Reader for free at Adobe.com