Skip to Content

Mucin 17 domain CRD1-L-CRD2

Antibody: CPTC-MUC17 CRD1-L-CRD2-1

Background

Catalog Number:
CPTC-MUC17 CRD1-L-CRD2-1
Target Antigen:
Mucin 17 domain CRD1-L-CRD2
Isotype:
IgG2a
Species:
Mouse
Last Updated:
12/18/2013
Antigen Recognition(s):

Characterization Data [Compare Characterization Data]

Western Blot

Click to enlarge image Western Blot using CPTC-MUC17-CRD1-L-CRD2-1 as primary Ab against MUC17-CRD1-L-CRD2 (rAg 00006) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).
Click to enlarge

CPTC-MUC17 CRD1-L-CRD2-1 Western blot

Western Blot using CPTC-MUC17-CRD1-L-CRD2-1 as primary Ab against MUC17-CRD1-L-CRD2 (rAg 00006) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).

Characterization SOP Files

Western Blot

Click to enlarge image Western Blot using CPTC-MUC17-CRD1-L-CRD2-1 as primary Ab against MUC17-CRD1-L-CRD2 (rAg 00006) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).
Click to enlarge

CPTC-MUC17 CRD1-L-CRD2-1 Western blot

Western Blot using CPTC-MUC17-CRD1-L-CRD2-1 as primary Ab against MUC17-CRD1-L-CRD2 (rAg 00006) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).

Indirect ELISA

Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding.
Click to enlarge

CPTC-MUC17 CRD1-L-CRD2 -1 Indirect ELISA

Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding.

Characterization SOP Files

Indirect ELISA

Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding.
Click to enlarge

CPTC-MUC17 CRD1-L-CRD2 -1 Indirect ELISA

Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding.

Antibody: CPTC-MUC17 CRD1-L-CRD2-2

Background

Catalog Number:
CPTC-MUC17 CRD1-L-CRD2-2
Target Antigen:
Mucin 17 domain CRD1-L-CRD2
Isotype:
IgG2a
Species:
Mouse
Last Updated:
12/18/2013
Antigen Recognition(s):

Characterization Data [Compare Characterization Data]

Western Blot

Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding.
Click to enlarge

CPTC-MUC17 CRD1-L-CRD2 -2 Indirect ELISA

Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding.

Characterization SOP Files

Western Blot

Click to enlarge image Western Blot using CPTC-MUC17-CRD1-L-CRD2-2 as primary Ab against MUC17-CRD1-L-CRD2 (rAg 00006) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).
Click to enlarge

CPTC-MUC17 CRD1-L-CRD2-2 Western blot

Western Blot using CPTC-MUC17-CRD1-L-CRD2-2 as primary Ab against MUC17-CRD1-L-CRD2 (rAg 00006) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).

Antibody: CPTC-MUC17 CRD1-L-CRD2-3

Background

Catalog Number:
CPTC-MUC17 CRD1-L-CRD2-3
Target Antigen:
Mucin 17 domain CRD1-L-CRD2
Isotype:
IgG2a
Species:
Mouse
Last Updated:
12/18/2013
Antigen Recognition(s):

Characterization Data [Compare Characterization Data]

Western Blot

Click to enlarge image Western Blot using CPTC-MUC17-CRD1-L-CRD2-3 as primary Ab against MUC17-CRD1-L-CRD2 (rAg 00006) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).
Click to enlarge

CPTC-MUC17 CRD1-L-CRD2-3 Western blot

Western Blot using CPTC-MUC17-CRD1-L-CRD2-3 as primary Ab against MUC17-CRD1-L-CRD2 (rAg 00006) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).

Indirect ELISA

Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding.
Click to enlarge

CPTC-MUC17 CRD1-L-CRD2 -3 Indirect ELISA

Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding.

Antigen: Mucin 17 domain CRD1-L-CRD2

Background

NCI Identification Number:
00006
Antigen Name:
Mucin 17 domain CRD1-L-CRD2
CPTC Name:
CPTC-MUC17 CRD1-L-CRD2
Keywords:
intestinal membrane mucin MUC17; mucin 17; small intestinal mucin-3; secreted mucin MUC17; MUC-17; MUC3

Function:
MUC17 comprises of a signal peptide, a large central tandemly repeated central domain (TR), two EGF-like domains, a SEA (sea urchin sperm protein, enterokinase, and agrin) domain, a transmembrane domain (TM) and an 80 amino acid cytoplasmic tail (Cyt).

Human MUC17 and mouse homolog of human MUC17 i.e. Muc3 are highly expressed in the gallbladder, intestine, and colon and are localized in the upper villi of the intestine and on the surface and upper crypt cells of the colon. The expression of MUC17 is down regulated in ulcerative colitis (UC) and Crohn's disease (CD) as compared to normal controls. In addition to the inflammatory bowel disease (IBD), there is significant downregulation of MUC17 expression in the neoplastic conditions of colon such as hyperplastic polyps, tubular and tubulovillous adenoma and colon adenocarcinoma.

The extracellular regions contains two EGF-like Cys-rich domains (CRD1 and CRD2) connected by an intervening linker segment with SEA module (L), that may function to stimulate intestinal cell restitution.
Chromosomal Localization:
7q22
Expression System:
E.coli
NCBI Accession Number:
NM_001040105
Swiss Prot Accession Number:
Q685J3
DNA Source:
MUC17-CRD1-L-CRD2 coding region was amplified from human intestinal cDNA
Immunogen:
Recombinant Domain
Vector Name:
pET28
Extinction Coefficient:
28780
Buffers:
50mM Tris (pH 8.2) buffer
Expressed Sequence:
RTTSRGCTTSASTLSATSTPHTSTSVTTRPVTPSSESSRPSTITSHTIPPTFPPAHSSTPPTTSA
SSTTVNPEAVTTMTTRTKPSTRTTSFPTVTTTAVPTNTTIKSNPTSTPTVPRTTTCFGDGCQNTA
SRCKNGGTWDGLKCQCPNLYYGELCEEVVSSIDIGPPETISAQMELTVTVTSVKFTEELKNHSSQ
EFQEFKQTFTEQMNIVYSGIPEYVGVNITKLRLGSVVVEHDVLLRTKYTPEYKTVLDNATEVVKE
KITKVTTQQIMINDICSDMMCFNTTGTQVQNITVTQYDPEEDCRKMAKEYGDYFVVEYRDQKPYC
ISPCEPGFSVSKNCNLGKCQMSLSGPQCLCVTTETHWYSGETCNQGTQKSV4390EHHHHHH
Native Sequence:
Calculated Isoelectric Point:
0
Molecular Weight:
42062
Last Updated:
11/28/2012

Links

Characterization Data

SOPs

Adobe Reader™ required.

Get Adobe Reader for free at Adobe.com