Skip to Content

Moesin

Antibody: CPTC-MSN-1

Background

Catalog Number:
CPTC-MSN-1
Target Antigen:
Moesin
Isotype:
IgG1
Species:
Mouse
Last Updated:
04/09/2013
Antigen Recognition(s):

Purchase

Characterization Data [Compare Characterization Data]

Western Blot

Click to enlarge image Western Blot using CPTC-MSN-1 as primary Ab against rAg 10782 (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG as control for goat anti-mouse HRP secondary binding (lane 3).
Click to enlarge

CPTC-MSN-1 Western blot

Western Blot using CPTC-MSN-1 as primary Ab against rAg 10782 (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG as control for goat anti-mouse HRP secondary binding (lane 3).

Cell Lysate Western Blot

Click to enlarge image Western Blot using CPTC-MSN-1 as primary Ab against cell lysate from transiently overexpressed HEK293T cells form Origene (lane 2). Also included are molecular wt. standards (lane 1), lysate from non-transfected HEK293T cells as neg control (lane 3) and recombinant Ag MSN (NCI 10782) in (lane 4).
Click to enlarge

CPTC-MSN-1 Cell Lysate blot

Western Blot using CPTC-MSN-1 as primary Ab against cell lysate from transiently overexpressed HEK293T cells form Origene (lane 2). Also included are molecular wt. standards (lane 1), lysate from non-transfected HEK293T cells as neg control (lane 3) and recombinant Ag MSN (NCI 10782) in (lane 4).

Indirect ELISA

Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate)
Click to enlarge

CPTC-MSN-1 Indirect ELISA

Indirect ELISA (ie, binding of Antibody to Antigen coated plate)

Characterization SOP Files

NCI 60 Protein Array

Click to enlarge image Protein Array in which CPTC-MSN-1 is screened against the NCI60 cell line panel for expression. Data is normalized to a mean signal of 1.0 and standard deviation of 0.5. Color conveys over-expression level (green), basal level (blue), under-expression level (red).
Click to enlarge

CPTC-MSN-1 Protein Array

Protein Array in which CPTC-MSN-1 is screened against the NCI60 cell line panel for expression. Data is normalized to a mean signal of 1.0 and standard deviation of 0.5. Color conveys over-expression level (green), basal level (blue), under-expression level (red).

IHC HPA

Download CPTC-MSN-1.pdf (91.1 KB)

CPTC-MSN-1 Evaluation

This PDF contains the evaluation results provided by the Human Protein Atlas (www.proteinatlas.org)

Array
Antibody: CPTC-MSN-2

Background

Catalog Number:
CPTC-MSN-2
Target Antigen:
Moesin
Isotype:
IgG1
Species:
Mouse
Last Updated:
04/09/2013
Antigen Recognition(s):

Purchase

Characterization Data [Compare Characterization Data]

Western Blot

Click to enlarge image Western Blot using CPTC-MSN-2 as primary Ab against rAg 10782 (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG as control for goat anti-mouse HRP secondary binding (lane 3).
Click to enlarge

CPTC-MSN-2 Western blot

Western Blot using CPTC-MSN-2 as primary Ab against rAg 10782 (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG as control for goat anti-mouse HRP secondary binding (lane 3).

Cell Lysate Western Blot

Click to enlarge image Western Blot using CPTC-MSN-2 as primary Ab against cell lysate from transiently overexpressed HEK293T cells form Origene (lane 2). Also included are molecular wt. standards (lane 1), lysate from non-transfected HEK293T cells as neg control (lane 3) and recombinant Ag MSN (NCI 10782) in (lane 4).
Click to enlarge

CPTC-MSN-2 Cell Lysate blot

Western Blot using CPTC-MSN-2 as primary Ab against cell lysate from transiently overexpressed HEK293T cells form Origene (lane 2). Also included are molecular wt. standards (lane 1), lysate from non-transfected HEK293T cells as neg control (lane 3) and recombinant Ag MSN (NCI 10782) in (lane 4).

Indirect ELISA

Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate)
Click to enlarge

CPTC-MSN-2 Indirect ELISA

Indirect ELISA (ie, binding of Antibody to Antigen coated plate)

Characterization SOP Files

NCI 60 Protein Array

Click to enlarge image Protein Array in which CPTC-MSN-2 is screened against the NCI60 cell line panel for expression. Data is normalized to a mean signal of 1.0 and standard deviation of 0.5. Color conveys over-expression level (green), basal level (blue), under-expression level (red).
Click to enlarge

CPTC-MSN-2 Protein Array

Protein Array in which CPTC-MSN-2 is screened against the NCI60 cell line panel for expression. Data is normalized to a mean signal of 1.0 and standard deviation of 0.5. Color conveys over-expression level (green), basal level (blue), under-expression level (red).

IHC HPA

Download CPTC-MSN-2.pdf (103.2 KB)

CPTC-MSN-2 Evaluation by Human Protein Atlas

This PDF contains the evaluation results provided by the Human Protein Atlas (www.proteinatlas.org)

Array
Antibody: CPTC-MSN-3

Background

Catalog Number:
CPTC-MSN-3
Target Antigen:
Moesin
Isotype:
IgG1
Species:
Mouse
Last Updated:
03/07/2013
Antigen Recognition(s):

Purchase

External Links

Characterization Data [Compare Characterization Data]

Western Blot

Click to enlarge image Western Blot using CPTC-MSN-3 as primary Ab against rAg 10782 (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG as control for goat anti-mouse HRP secondary binding (lane 3).
Click to enlarge

CPTC-MSN-3 Western blot

Western Blot using CPTC-MSN-3 as primary Ab against rAg 10782 (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG as control for goat anti-mouse HRP secondary binding (lane 3).

Cell Lysate Western Blot

Click to enlarge image Western Blot using CPTC-MSN-3 as primary Ab against cell lysate from transiently overexpressed HEK293T cells form Origene (lane 2). Also included are molecular wt. standards (lane 1), lysate from non-transfected HEK293T cells as neg control (lane 3) and recombinant Ag MSN (NCI 10782) in (lane 4).
Click to enlarge

CPTC-MSN-3 Cell Lysate Western blot

Western Blot using CPTC-MSN-3 as primary Ab against cell lysate from transiently overexpressed HEK293T cells form Origene (lane 2). Also included are molecular wt. standards (lane 1), lysate from non-transfected HEK293T cells as neg control (lane 3) and recombinant Ag MSN (NCI 10782) in (lane 4).

Indirect ELISA

Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate)
Click to enlarge

CPTC-MSN-3 Indirect ELISA

Indirect ELISA (ie, binding of Antibody to Antigen coated plate)

Characterization SOP Files

NCI 60 Protein Array

Click to enlarge image Protein Array in which CPTC-MSN-3 is screened against the NCI60 cell line panel for expression. Data is normalized to a mean signal of 1.0 and standard deviation of 0.5. Color conveys over-expression level (green), basal level (blue), under-expression level (red).
Click to enlarge

CPTC-MSN-3 Protein Array

Protein Array in which CPTC-MSN-3 is screened against the NCI60 cell line panel for expression. Data is normalized to a mean signal of 1.0 and standard deviation of 0.5. Color conveys over-expression level (green), basal level (blue), under-expression level (red).

IHC Tissue

Click to enlarge image Tissue Micro-Array(TMA) core of ovarian cancer  showing cytoplasmic staining using Antibody CPTC-MSN-3. Titer: 1:15000
Click to enlarge

CPTC-MSN-3 IHC Tissue

Tissue Micro-Array(TMA) core of ovarian cancer showing cytoplasmic staining using Antibody CPTC-MSN-3. Titer: 1:15000

IHC HPA

Download CPTC-MSN-3.pdf (110.7 KB)

CPTC-MSN-3 Evaluation by Human Protein Atlas

This PDF contains the evaluation results provided by the Human Protein Atlas (www.proteinatlas.org)

Array
Antigen: Moesin

Background

NCI Identification Number:
10782
Antigen Name:
Moesin
CPTC Name:
CPTC-MSN
Keywords:
Function:
Moesin (for membrane-organizing extension spike protein) is a member of the ERM family which includes ezrin and radixin. ERM proteins appear to function as cross-linkers between plasma membranes and actin-based cytoskeletons.
Moesin is localized to filopodia and other membranous protrusions that are important for cell-cell recognition and signaling and for cell movement.
Chromosomal Localization:
Xq11.2 - q12
Expression System:
E. Coli
NCBI Accession Number:
BC017293
Swiss Prot Accession Number:
P26038
DNA Source:
DNASU - HsCD00041631
Immunogen:
Recombinant Full Length Protein
Vector Name:
MCSG7
Extinction Coefficient:
57933
Buffers:
PBS without Ca++ and Mg++
Expressed Sequence:
SNAMPKTISVRVTTMDAELEFAIQPNTTGKQLFDQVVKTIGLREVWFFGLQYQDTKGFSTWLKLN
KKVTAQDVRKESPLLFKFRAKFYPEDVSEELIQDITQRLFFLQVKEGILNDDIYCPPETAVLLAS
YAVQSKYGDFNKEVHKSGYLAGDKLLPQRVLEQHKLNKDQWEERIQVWHEEHRGMLREDAVLEYL
KIAQDLEMYGVNYFSIKNKKGSELWLGVDALGLNIYEQNDRLTPKIGFPWSEIRNISFNDKKFVI
KPIDKKAPDFVFYAPRLRINKRILALCMGNHELYMRRRKPDTIEVQQMKAQAREEKHQKQMERAM
LENEKKKREMAEKEKEKIEREKEELMERLKQIEEQTKKAQQELEEQTRRALELEQERKRAQSEAE
KLAKERQEAEEAKEALLQASRDQKKTQEQLALEMAELTARISQLEMARQKKESEAVEWQQKAQMV
QEDLEKTRAELKTAMSTPHVAEPAENEQDEQDENGAEASADLRADAMAKDRSEEERTTEAEKNER
VQKHLKALTSELANARDESKKTANDMIHAENMRLGRDKYKTLRQIRQGNTKQRIDEFESM
Native Sequence:
MPKTISVRVTTMDAELEFAIQPNTTGKQLFDQVVKTIGLREVWFFGLQYQDTKGFSTWLKLNKKV
TAQDVRKESPLLFKFRAKFYPEDVSEELIQDITQRLFFLQVKEGILNDDIYCPPETAVLLASYAV
QSKYGDFNKEVHKSGYLAGDKLLPQRVLEQHKLNKDQWEERIQVWHEEHRGMLREDAVLEYLKIA
QDLEMYGVNYFSIKNKKGSELWLGVDALGLNIYEQNDRLTPKIGFPWSEIRNISFNDKKFVIKPI
DKKAPDFVFYAPRLRINKRILALCMGNHELYMRRRKPDTIEVQQMKAQAREEKHQKQMERAMLEN
EKKKREMAEKEKEKIEREKEELMERLKQIEEQTKKAQQELEEQTRRALELEQERKRAQSEAEKLA
KERQEAEEAKEALLQASRDQKKTQEQLALEMAELTARISQLEMARQKKESEAVEWQQKAQMVQED
LEKTRAELKTAMSTPHVAEPAENEQDEQDENGAEASADLRADAMAKDRSEEERTTEAEKNERVQK
HLKALTSELANARDESKKTANDMIHAENMRLGRDKYKTLRQIRQGNTKQRIDEFESM
Calculated Isoelectric Point:
6.07
Molecular Weight:
68092
Last Updated:
11/14/2012

Links

Characterization Data

SOPs

Adobe Reader™ required.

Get Adobe Reader for free at Adobe.com