Skip to Content

Multiple endocrine neoplasia I

Antibody: CPTC-MEN1-1

Background

Catalog Number:
CPTC-MEN1-1
Target Antigen:
Multiple endocrine neoplasia I
Isotype:
IgG1
Species:
Mouse
Last Updated:
06/12/2014
Antigen Recognition(s):

Characterization Data [Compare Characterization Data]

Western Blot

Click to enlarge image Western Blot using CPTC-MEN1-1 as primary Ab against MEN1 (rAg 00058) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).
Click to enlarge

CPTC-MEN1-1 Western blot

Western Blot using CPTC-MEN1-1 as primary Ab against MEN1 (rAg 00058) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).

Indirect ELISA

Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding.
Click to enlarge

CPTC-MEN1-1 Indirect ELISA

Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding.

Characterization SOP Files

NCI 60 Protein Array

CPTC-MEN1-1 NCI 60 Protein Array

This antibody is not suitable for use in a Reverse Phase Protein Array format as described in SOP M-105.

Antigen: Multiple endocrine neoplasia I

Background

NCI Identification Number:
00058
Antigen Name:
Multiple endocrine neoplasia I
CPTC Name:
CPTC-MEN1
Keywords:
SCG2; MEAI; Menin
Function:
Chromosomal Localization:
11q13
Expression System:
E. coli
NCBI Accession Number:
NP_000235.2
Swiss Prot Accession Number:
O00255
DNA Source:
Mammalian Gene Collection
Immunogen:
Recombinant Full Length Protein
Vector Name:
pET28-MHL
Extinction Coefficient:
Buffers:
PBS pH 7.4
Expressed Sequence:
MHHHHHHSSGRENLYFQGMGLKAAQKTLFPLRSIDDVVRLFAAELGREEPDLVLLSLVLG
FVEHFLAVNRVIPTNVPELTFQPSPAPDPPGGLTYFPVADLSIIAALYARFTAQIRGAVD
LSLYPREGGVSSRELVKKVSDVIWNSLSRSYFKDRAHIQSLFSFITGTKLDSSGVAFAVV
GACQALGLRDVHLALSEDHAWVVFGPNGEQTAEVTWHGKGNEDRRGQTVNAGVAERSWLY
LKGSYMRCDRKMEVAFMVCAINPSIDLHTDSLELLQLQQKLLWLLYDLGHLERYPMALGN
LADLEELEPTPGRPDPLTLYHKGIASAKTYYRDEHIYPYMYLAGYHCRNRNVREALQAWA
DTATVIQDYNYCREDEEIYKEFFEVANDVIPNLLKEAASLLEAGEERPGEQSQGTQSQGS
ALQDPECFAHLLRFYDGICKWEEGSPTPVLHVGWATFLVQSLGRFEGQVRQKVRIVSREA
EAAEAEEPWGEEAREGRRRGPRRESKPEEPPPPKKPALDKGLGTGQGAVSGP
Native Sequence:
Calculated Isoelectric Point:
5.6
Molecular Weight:
59520
Last Updated:
10/25/2013

Links

Characterization Data

Gel

Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding.
Click to enlarge

CPTC-MEN1 PAGE

PAGE of MEN1 (rAg 00058) with molecular weight standards in lane 1

SOPs

Adobe Reader™ required.

Get Adobe Reader for free at Adobe.com