Skip to Content

Melanoma Antigen Family A, 4

Antibody: CPTC-MAGEA4-1

Background

Catalog Number:
CPTC-MAGEA4-1
Target Antigen:
Melanoma Antigen Family A, 4
Isotype:
IgG2a
Species:
Mouse
Last Updated:
12/16/2011
Antigen Recognition(s):
recombinant full-length

Purchase

External Links

Characterization Data [Compare Characterization Data]

Western Blot

Click to enlarge image Western Blot using CPTC-MAGEA4-1 as primary Ab against Ag 10479 (lane 2).
Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).
Click to enlarge

CPTC-MAGEA4-1 Western Blot

Western Blot using CPTC-MAGEA4-1 as primary Ab against Ag 10479 (lane 2).
Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).

Indirect ELISA

Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate)
Click to enlarge

CPTC-MAGEA4-1 Indirect ELISA

Indirect ELISA (ie, binding of Antibody to Antigen coated plate)

NCI 60 Protein Array

Click to enlarge image Protein Array in which CPTC-MAGEA4-1 is screened against the NCI60 cell line panel for expression. Data is normalized to a mean signal of 1.0 and standard deviation of 0.5.
Click to enlarge

CPTC-MAGEA4-1 NCI60 Protein Array

Protein Array in which CPTC-MAGEA4-1 is screened against the NCI60 cell line panel for expression. Data is normalized to a mean signal of 1.0 and standard deviation of 0.5.

IHC NCI60

Click to enlarge image Immuno-histochemistry of CPTC-MAGEA4-1 for NCI60  Cell Line Array at titer 1:100
0=NEGATIVE
1=WEAK(red)
2=MODERATE(blue)
3=STRONG(green)
Click to enlarge

CPTC-MAGEA4-1 IHC NCI60

Immuno-histochemistry of CPTC-MAGEA4-1 for NCI60 Cell Line Array at titer 1:100
0=NEGATIVE
1=WEAK(red)
2=MODERATE(blue)
3=STRONG(green)

Click to view IHC NCI60 Cell Line Array example

IHC Tissue

Click to enlarge image Tissue Micro-Array(TMA) core of breast cancer showing cytoplasmic staining using Antibody CPTC-MAGEA4-1. Titer: 1:100
Click to enlarge

CPTC-MAGEA4-1 IHC Tissue

Tissue Micro-Array(TMA) core of breast cancer showing cytoplasmic staining using Antibody CPTC-MAGEA4-1. Titer: 1:100

Antibody: CPTC-MAGEA4-2

Background

Catalog Number:
CPTC-MAGEA4-2
Target Antigen:
Melanoma Antigen Family A, 4
Isotype:
IgG2b
Species:
Mouse
Last Updated:
12/16/2011
Antigen Recognition(s):
recombinant full-length

Purchase

Characterization Data [Compare Characterization Data]

Western Blot

Click to enlarge image Western Blot using CPTC-MAGEA4-2 as primary Ab against Ag 10479 (lane 2).
Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).
Click to enlarge

CPTC-MAGEA4-2 Western blot

Western Blot using CPTC-MAGEA4-2 as primary Ab against Ag 10479 (lane 2).
Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).

Indirect ELISA

Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate)
Click to enlarge

CPTC-MAGEA4-2 Indirect ELISA

Indirect ELISA (ie, binding of Antibody to Antigen coated plate)

NCI 60 Protein Array

Click to enlarge image Protein Array in which CPTC-MAGEA4-2 is screened against the NCI60 cell line panel for expression. Data is normalized to a mean signal of 1.0 and standard deviation of 0.5. Color conveys over-expression level (green), basal level (blue), under-expression level (red).
Click to enlarge

CPTC-MAGEA4-2 NCI60 Protein Array

Protein Array in which CPTC-MAGEA4-2 is screened against the NCI60 cell line panel for expression. Data is normalized to a mean signal of 1.0 and standard deviation of 0.5. Color conveys over-expression level (green), basal level (blue), under-expression level (red).

IHC NCI60

Click to enlarge image Immuno-histochemistry of CPTC-MAGEA4-2 for NCI60  Cell Line Array at titer 1:1250
0=NEGATIVE
1=WEAK(red)
2=MODERATE(blue)
3=STRONG(green)
Click to enlarge

CPTC-MAGEA4-2 IHC NCI60

Immuno-histochemistry of CPTC-MAGEA4-2 for NCI60 Cell Line Array at titer 1:1250
0=NEGATIVE
1=WEAK(red)
2=MODERATE(blue)
3=STRONG(green)

Click to view IHC NCI60 Cell Line Array example

IHC Tissue

Click to enlarge image Tissue Micro-Array(TMA) core of breast cancer showing cytoplasmic staining using Antibody CPTC-MAGEA4-2. Titer: 1:1250
Click to enlarge

CPTC-MAGEA4-2 IHC Tissue

Tissue Micro-Array(TMA) core of breast cancer showing cytoplasmic staining using Antibody CPTC-MAGEA4-2. Titer: 1:1250

Antibody: CPTC-MAGEA4-3

Background

Catalog Number:
CPTC-MAGEA4-3
Target Antigen:
Melanoma Antigen Family A, 4
Isotype:
IgG1
Species:
Mouse
Last Updated:
12/16/2011
Antigen Recognition(s):
recombinant full-length

Purchase

Characterization Data [Compare Characterization Data]

Western Blot

Click to enlarge image Western Blot using CPTC-MAGEA4-3 as primary Ab against Ag 10479 (lane 2).
Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).
Click to enlarge

CPTC-MAGEA4-3 Western blot

Western Blot using CPTC-MAGEA4-3 as primary Ab against Ag 10479 (lane 2).
Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).

Indirect ELISA

Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate)
Click to enlarge

CPTC-MAGEA4-3 Indirect ELISA

Indirect ELISA (ie, binding of Antibody to Antigen coated plate)

Antigen: Melanoma Antigen Family A, 4

Background

NCI Identification Number:
10479
Antigen Name:
Melanoma Antigen Family A, 4
CPTC Name:
CPTC-MAGEA4
Keywords:
CT1.4; MAGE-41; MAGE-X2; MAGE4; MAGE4A; MAGE4B; MGC21336; OTTHUMP00000025889; OTTHUMP00000025890
Function:
This gene is a member of the MAGEA gene family. The members of this family encode proteins with 50 to 80% sequence identity to each other. The promoters and first exons of the MAGEA genes show considerable variability, suggesting that the existence of this gene family enables the same function to be expressed under different transcriptional controls. The MAGEA genes are clustered at chromosomal location Xq28. They have been implicated in some hereditary disorders, such as dyskeratosis congenita. At least four variants encoding the same protein have been found for this gene. The function is not known, though may play a role in embryonal development and tumor transformation or aspects of tumor progression
Chromosomal Localization:
Xq28
Expression System:
E. Coli
NCBI Accession Number:
BC017723.1
Swiss Prot Accession Number:
P43358
DNA Source:
HIP: HsCD00043768
Immunogen:
Recombinant Full Length Protein
Vector Name:
pMCSG7
Extinction Coefficient:
38515
Buffers:
50mM NH4HC03
Expressed Sequence:
SNAMSSEQKSQHCKPEEGVEAQEEALGLVGAQAPTTEEQEAAVSSSSPLVPGTLEEVPAAESAG
PPQSPQGASALPTTISFTCWRQPNEGSSSQEEEGPSTSPDAESLFREALSNKVDELAHFLLRKY
RAKELVTKAEMLERVIKNYKRCFPVIFGKASESLKMIFGIDVKEVDPTSNTYTLVTCLGLSYDG
LLGNNQIFPKTGLLIIVLGTIAMEGDSASEEEIWEELGVMGVYDGREHTVYGEPRKLLTQDWVQ
ENYLEYRQVPGSNPARYEFLWGPRALAETSYVKVLEHVVRVNARVRIAYPSLREAALLEEEEGV
Native Sequence:
MSSEQKSQHCKPEEGVEAQEEALGLVGAQAPTTEEQEAAVSSSSPLVPGTLEEVPAAESAGPPQ
SPQGASALPTTISFTCWRQPNEGSSSQEEEGPSTSPDAESLFREALSNKVDELAHFLLRKYRAK
ELVTKAEMLERVIKNYKRCFPVIFGKASESLKMIFGIDVKEVDPTSNTYTLVTCLGLSYDGLLG
NNQIFPKTGLLIIVLGTIAMEGDSASEEEIWEELGVMGVYDGREHTVYGEPRKLLTQDWVQENY
LEYRQVPGSNPARYEFLWGPRALAETSYVKVLEHVVRVNARVRIAYPSLREAALLEEEEGV
Calculated Isoelectric Point:
4.68
Molecular Weight:
35201
Last Updated:
11/14/2012

Links

Characterization Data

Gel

Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate)
Click to enlarge

CPTC-MAGEA4

PAGE of Ag 10479 (with molecular weight standards in lane 1)

SOPs

Adobe Reader™ required.

Get Adobe Reader for free at Adobe.com