Skip to Content

LIN-28 homolog A

Antibody: CPTC-LIN28A-1

Background

Catalog Number:
CPTC-LIN28A-1
Target Antigen:
LIN-28 homolog A
Isotype:
IgG2b
Species:
Mouse
Last Updated:
06/12/2014
Antigen Recognition(s):

Characterization Data [Compare Characterization Data]

Indirect ELISA

Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding.
Click to enlarge

CPTC-LIN28A-1 Indirect ELISA

Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding.

Characterization SOP Files

NCI 60 Protein Array

CPTC-LIN28A-1 NCI 60 Protein Array

This antibody is not suitable for use in a Reverse Phase Protein Array format as described in SOP M-105.

Antigen: LIN-28 homolog A

Background

NCI Identification Number:
00059
Antigen Name:
LIN-28 homolog A
CPTC Name:
CPTC-LIN28A
Keywords:
LIN28; CSDD1; ZCCHC1; LIN-28; Zinc Finger CCHC Domain-Containing Protein 1; FLJ12457; Lin-28 Homolog (C. Elegans); Lin-28A; Protein Lin-28 Homolog A; RNA-Binding Protein LIN-28; Zinc Finger, CCHC Domain Containing 1
Function:
Acts as a 'translational enhancer', driving specific mRNAs to polysomes and thus increasing the efficiency of protein synthesis. Its association with the translational machinery and target mRNAs results in an increased number of initiation events per molecule of mRNA and, indirectly, in stabilizing the mRNAs. Binds IGF2 mRNA, MYOD1 mRNA, ARBP/36B4 ribosomal protein mRNA and its own mRNA. Essential for skeletal muscle differentiation program through the translational up-regulation of IGF2 expression (By similarity). Acts as a suppressor of microRNA (miRNA) biogenesis by specifically binding the precursor let-7 (pre-let-7), a miRNA precursor. Acts by binding pre-let-7 and recruiting ZCCHC11/TUT4 uridylyltransferase, leading to the terminal uridylation of pre-let-7. Uridylated pre-let-7 miRNAs fail to be processed by Dicer and undergo degradation. Degradation of pre-let-7 in embryonic stem (ES) cells contributes to the maintenance of ES cells. In contrast, LIN28A down-regulation in neural stem cells by miR-125, allows the processing of pre-let-7. Specifically recognizes the 5'-GGAG-3' motif in the terminal loop of pre-let-7. Also recognizes and binds non pre-let-7 pre-miRNAs that contain the 5'-GGAG-3' motif in the terminal loop, leading to their terminal uridylation and subsequent degradation.
Chromosomal Localization:
1p36.11
Expression System:
E. coli
NCBI Accession Number:
NP_078950.1
Swiss Prot Accession Number:
Q9H9Z2
DNA Source:
Mammalian Gene Collection
Immunogen:
Recombinant Full Length Protein
Vector Name:
pET28-MHL
Extinction Coefficient:
Buffers:
PBS pH 7.4
Expressed Sequence:
mhhhhhhssgrenlyfqgMGSVSNQQFAGGCAKAAEEAPEEAPEDA
ARAADEPQLLHGAGICKWFNVRMGFGFLSMTARAGVALDPPVDVFV
HQSKLHMEGFRSLKEGEAVEFTFKKSAKGLESIRVTGPGGVFCIGS
ERRPKGKSMQKRRSKGDRCYNCGGLDHHAKECKLPPQPKKCHFCQS
ISHMVASCPLKAQQGPSAQGKPTYFREEEEEIHSPTLLPEAQN
Native Sequence:
Calculated Isoelectric Point:
7.9
Molecular Weight:
24936
Last Updated:
10/25/2013

Links

Characterization Data

Gel

Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding.
Click to enlarge

CPTC-LIN28A PAGE

PAGE of LIN28A (rAg 00059) with molecular weight standards in lane 1

SOPs

Adobe Reader™ required.

Get Adobe Reader for free at Adobe.com