Skip to Content

KIAA1967

Antibody: CPTC-KIAA1967-1

Background

Catalog Number:
CPTC-KIAA1967-1
Target Antigen:
KIAA1967
Isotype:
IgG2b
Species:
Mouse
Last Updated:
06/12/2014
Antigen Recognition(s):

Characterization Data [Compare Characterization Data]

Western Blot

Click to enlarge image Western Blot using CPTC-KIAA1967-1 as primary Ab against KIAA1967 (rAg 00056) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).
Click to enlarge

CPTC-KIAA1967-1 Western blot

Western Blot using CPTC-KIAA1967-1 as primary Ab against KIAA1967 (rAg 00056) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).

Indirect ELISA

Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding.
Click to enlarge

CPTC-KIAA1967-1 Indirect ELISA

Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding.

NCI 60 Protein Array

Click to enlarge image Protein Array in which CPTC-KIAA1967-1 is screened against the NCI60 cell line panel for expression. Data is normalized to a mean signal of 1.0 and standard deviation of 0.5. Color conveys over-expression level (green), basal level (blue), under-expression level (red).
Click to enlarge

CPTC-KIAA1967-1 NCI 60 Protein Array

Protein Array in which CPTC-KIAA1967-1 is screened against the NCI60 cell line panel for expression. Data is normalized to a mean signal of 1.0 and standard deviation of 0.5. Color conveys over-expression level (green), basal level (blue), under-expression level (red).

Antibody: CPTC-KIAA1967-2

Background

Catalog Number:
CPTC-KIAA1967-2
Target Antigen:
KIAA1967
Isotype:
IgG2b
Species:
Mouse
Last Updated:
05/14/2014
Antigen Recognition(s):

Characterization Data [Compare Characterization Data]

Western Blot

Click to enlarge image Western Blot using CPTC-KIAA1967-2 as primary Ab against KIAA1967 (rAg 00056) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).
Click to enlarge

CPTC-KIAA1967-2 Western blot

Western Blot using CPTC-KIAA1967-2 as primary Ab against KIAA1967 (rAg 00056) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).

Indirect ELISA

Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding.
Click to enlarge

CPTC-KIAA1967-2 Indirect ELISA

Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding.

NCI 60 Protein Array

CPTC-KIAA1967-2 NCI 60 Protein Array

This antibody is not suitable for use in a Reverse Phase Protein Array format as described in SOP M-105.

Antigen: KIAA1967

Background

NCI Identification Number:
00056
Antigen Name:
KIAA1967
CPTC Name:
CPTC-KIAA1967
Keywords:
DBC1; DBC-1; NET35; P30 DBC; DBIRD Complex Subunit KIAA1967; Deleted In Breast Cancer 1; P30 DBC Protein; P30DBC; DBC.1; Deleted In Breast Cancer Gene 1 Protein
Function:
Core component of the DBIRD complex, a multiprotein complex that acts at the interface between core mRNP particles and RNA polymerase II (RNAPII) and integrates transcript elongation with the regulation of alternative splicing: the DBIRD complex affects local transcript elongation rates and alternative splicing of a large set of exons embedded in (A + T)-rich DNA regions. Inhibits SIRT1 deacetylase activity leading to increasing levels of p53/TP53 acetylation and p53-mediated apoptosis. Inhibits SUV39H1 methyltransferase activity
Chromosomal Localization:
8p22
Expression System:
E. coli
NCBI Accession Number:
NP_066997.3
Swiss Prot Accession Number:
Q8N163
DNA Source:
Mammalian Gene Collection
Immunogen:
Recombinant Full Length Protein
Vector Name:
pET28-MHL
Extinction Coefficient:
Buffers:
PBS pH 7.4
Expressed Sequence:
MHHHHHHSSGRENLYFQGKKRKQRAGGEPWGAKKPRHDLPPYRVHLTP
YTVDSPICDFLELQRRYRSLLVPSDFLSVHLSWLSAFPLSQPFSLHHP
SRIQVSSEKEAAPDAGAEPITADSDPAYSSKVLLLSSPGLEELYRCCM
LFVDDMAEPRETPEHPLKQIKFLLGRKEEEAVLVGGEWSPSLDGLDPQ
ADPQVLVRTAIRCAQAQTGIDLSGCTKWWRFAEFQYLQPGPPRRLQTV
VVYLPDVWTIMPTLEEWEALCQQKAAEAAPPTQEAQGETEPTEQAPDA
LEQAADTSRRNAETPEATTQQETDTDLPEAPPPPLEPAVIARPGCVNL
SLHGIVEDRRPKERISFEVMVLAELFLEMLQRDFGYRVYKMLLSLPEK
VVSPPEPEKEEAAKEEATKEEEAIKEEVVKEPKDEAQNEGPATES
Native Sequence:
Calculated Isoelectric Point:
4.7
Molecular Weight:
48265
Last Updated:
10/24/2013

Links

Characterization Data

Gel

Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding.
Click to enlarge

CPTC-KIAA1967 PAGE

PAGE of KIAA1967 (rAg 00056) with molecular weight standards in lane 1

SOPs

Adobe Reader™ required.

Get Adobe Reader for free at Adobe.com