Skip to Content

itchy homolog E3 ubiquitin protein ligase

Antibody: CPTC-ITCH-1

Background

Catalog Number:
CPTC-ITCH-1
Target Antigen:
itchy homolog E3 ubiquitin protein ligase
Isotype:
IgG2b
Species:
Mouse
Last Updated:
11/26/2013
Antigen Recognition(s):

Purchase

Characterization Data [Compare Characterization Data]

Western Blot

Click to enlarge image Western Blot using CPTC-ITCH-1 as primary Ab against ITCH (rAg 00010) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).
Click to enlarge

CPTC-ITCH-1 Western blot

Western Blot using CPTC-ITCH-1 as primary Ab against ITCH (rAg 00010) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).

Indirect ELISA

Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding.
Click to enlarge

CPTC-ITCH-1 Indirect ELISA

Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding.

Characterization SOP Files

Antibody: CPTC-ITCH-2

Background

Catalog Number:
CPTC-ITCH-2
Target Antigen:
itchy homolog E3 ubiquitin protein ligase
Isotype:
IgG2b
Species:
Mouse
Last Updated:
11/26/2013
Antigen Recognition(s):

Purchase

Characterization Data [Compare Characterization Data]

Western Blot

Click to enlarge image Western Blot using CPTC-ITCH-2 as primary Ab against ITCH (rAg 00010) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).
Click to enlarge

CPTC-ITCH-2 Western blot

Western Blot using CPTC-ITCH-2 as primary Ab against ITCH (rAg 00010) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).

Indirect ELISA

Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding.
Click to enlarge

CPTC-ITCH-2 Indirect ELISA

Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding.

Characterization SOP Files

Antibody: CPTC-ITCH-3

Background

Catalog Number:
CPTC-ITCH-3
Target Antigen:
itchy homolog E3 ubiquitin protein ligase
Isotype:
IgG2b
Species:
Mouse
Last Updated:
11/26/2013
Antigen Recognition(s):

Purchase

Characterization Data [Compare Characterization Data]

Western Blot

Click to enlarge image Western Blot using CPTC-ITCH-3 as primary Ab against ITCH (rAg 00010) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).
Click to enlarge

CPTC-ITCH-3 Western blot

Western Blot using CPTC-ITCH-3 as primary Ab against ITCH (rAg 00010) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).

Indirect ELISA

Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding.
Click to enlarge

CPTC-ITCH-3 Indirect ELISA

Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding.

Characterization SOP Files

Antigen: itchy homolog E3 ubiquitin protein ligase

Background

NCI Identification Number:
00010
Antigen Name:
itchy homolog E3 ubiquitin protein ligase
CPTC Name:
CPTC-ITCH
Keywords:
itchy E3 ubiquitin protein ligase; AIP4; NAPP1; NFE2-associated polypeptide 1; itchy (mouse homolog) E3 ubiquitin protein ligase; itchy E3 ubiquitin protein ligase homolog (mouse); AIF4; atrophin-1 interacting protein 4; dJ468O1.1; dJ468O1.1 (atrophin 1 interacting protein 4 (AIP4)); E3 ubiquitin-protein ligase Itchy homolog; itchy E3 ubiquitin protein ligase homolog; EC 6.3.2; Atrophin-1-interacting protein 4;
Function:
This gene encodes a member of the Nedd4 family of HECT domain E3 ubiquitin ligases. HECT domain E3 ubiquitin ligases transfer ubiquitin from E2 ubiquitin-conjugating enzymes to protein substrates, thus targeting specific proteins for lysosomal degradation. The encoded protein plays a role in multiple cellular processes including erythroid and
lymphoid cell differentiation and the regulation of immune responses. Mutations in this gene are a cause of syndromic multisystem autoimmune disease. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene.

Acts as an E3 ubiquitin-protein ligase which accepts ubiquitin from an E2 ubiquitin-conjugating enzyme in the
form of a thioester and then directly transfers the ubiquitin to targeted substrates. It catalyzes 'Lys-29'-,
'Lys-48'- and 'Lys-63'-linked ubiquitin conjugation. It is involved in the control of inflammatory signaling pathways. Is an essential component of a ubiquitin-editing protein complex, comprising also TNFAIP3, TAX1BP1 and RNF11, that ensures the transient nature of inflammatory signaling pathways. Promotes the association of the complex after TNF stimulation. Once the complex is formed, TNFAIP3 deubiquitinates 'Lys-63' polyubiquitin chains on RIPK1 and catalyzes
the formation of 'Lys-48'-polyubiquitin chains. This leads to RIPK1 proteasomal degradation and consequently
termination of the TNF- or LPS-mediated activation of NFKB1. Ubiquitinates RIPK2 by 'Lys-63'-linked conjugation and
influences NOD2-dependent signal transduction pathways. Regulates the transcriptional activity of several
transcription factors, and probably plays an important role in the regulation of immune response. Ubiquitinates NFE2 by 'Lys-63' linkages and is implicated in the control of the development of hematopoietic lineages. Critical regulator of T-helper (TH2) cytokine development through its ability to induce JUNB ubiquitination and degradation (By similarity). Ubiquitinates SNX9. Ubiquitinates CXCR4 and HGS/HRS and regulates sorting of CXCR4 to the degradative pathway. It is involved in the negative regulation of MAVS-dependent cellular antiviral responses. Ubiquitinates MAVS
through 'Lys-48'-linked conjugation resulting in MAVS proteasomal degradation. Involved in the regulation of apoptosis and reactive oxygen species levels through the ubiquitination and proteasomal degradation of TXNIP. Mediates the
antiapoptotic activity of epidermal growth factor through the ubiquitination and proteasomal degradation of p15 BID.
Targets DTX1 for lysosomal degradation and controls NOTCH1 degradation, in the absence of ligand, through 'Lys-29'-linked polyubiquitination

Chromosomal Localization:
20q11.22
Expression System:
E. coli
NCBI Accession Number:
NM_008395
Swiss Prot Accession Number:
Q96J02
DNA Source:
Mammalian Gene Collection
Immunogen:
Recombinant Full Length Protein
Vector Name:
pET28-MHL
Extinction Coefficient:
Buffers:
PBS, pH 7.4
Expressed Sequence:
mhhhhhhssgrenlyfqgPSRPPPPTPRRPASVNGSPSATSESDGSSTGSLPPTNTNTNTSEGATSG
LIIPLTISGGSGPRPLNPVTQAPLPPGWEQRVDQHGRVYYVDHVEKRTTWDRPEPLPPGWERRVDNM
GRIYYVDHFTRTTTWQRPTLESVRNYEQWQLQRSQLQGAMQQFNQRFIYGNQDLFATSQSKEFDPLG
PLPPGWEKRTDSNGRVYFVNHNTRITQWEDPRSQGQLNEKPLPEGWEMRFTVDGIPYFVDHNRRTTT
YIDPRTGKSALDNGPQIAYVRDFKAKVQYFRFWCQQLAMPQHIKITVTRKTLFEDSFQQIMSFSPQD
LRRRLWVIFPGEEGLDYGGVAREWFFLLSHEVLNPMYCLFEYAGKDNYCLQINPASYINPDHLKYFR
FIGRFIAMALFHGKFIDTGFSLPFYKRILNKPVGLKDLESIDPEFYNSLIWVKENNIEECDLEMYFS
VDKEILGEIKSHDLKPNGGNILVTEENKEEYIRMVAEWRLSRGVEEQTQAFFEGFNEILPQQYLQYF
DAKELEVLLCGMQEIDLNDWQRHAIYRHYARTSKQIMWFWQFVKEIDNEKRMRLLQFVTGTCRLPVG
GFADLMGSNGPQKFCIEKVGKENWLPRSHTCFNRLDLPPYKSYEQLKEKLLFAIEETEGFGQE
Native Sequence:
Calculated Isoelectric Point:
6.4
Molecular Weight:
77784
Last Updated:
06/10/2013

Links

Characterization Data

Gel

Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding.
Click to enlarge

CPTC-ITCH PAGE

PAGE of ITCH (rAg 00010) with molecular weight standards in lane 1

SOPs

Adobe Reader™ required.

Get Adobe Reader for free at Adobe.com