Skip to Content

Interleukin 6

Antibody: CPTC-IL6-1

Background

Catalog Number:
CPTC-IL6-1
Target Antigen:
Interleukin 6
Isotype:
IgG1
Species:
Mouse
Last Updated:
02/12/2014
Antigen Recognition(s):
recombinant full-length

Purchase

Characterization Data [Compare Characterization Data]

Western Blot

Click to enlarge image Western Blot using CPTC-IL6-1 as primary Ab against IL6 (rAg 10142) in lane 2. Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).
Click to enlarge

CPTC-IL6-1 Western blot

Western Blot using CPTC-IL6-1 as primary Ab against IL6 (rAg 10142) in lane 2. Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).

Indirect ELISA

Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding.
Click to enlarge

CPTC-IL6-1 Indirect ELISA

Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding.

NCI 60 Protein Array

CPTC-IL6-1 NCI 60 Protein Array

This antibody is not suitable for use in a Reverse Phase Protein Array format as described in SOP M-105.

IHC NCI60

CPTC-IL6-1 IHC NCI60

This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.

Click to view IHC NCI60 Cell Line Array example

IHC Tissue

CPTC-IL6-1 IHC Tissue

This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.

Antibody: CPTC-IL6-2

Background

Catalog Number:
CPTC-IL6-2
Target Antigen:
Interleukin 6
Isotype:
IgG2a
Species:
Mouse
Last Updated:
04/29/2014
Antigen Recognition(s):
recombinant full-length

Purchase

Characterization Data [Compare Characterization Data]

Western Blot

Click to enlarge image Western Blot using CPTC-IL6-2 as primary Ab against IL6 (rAg 10142) in lane 2. Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).
Click to enlarge

CPTC-IL6-2 Western blot

Western Blot using CPTC-IL6-2 as primary Ab against IL6 (rAg 10142) in lane 2. Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).

Indirect ELISA

Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding.
Click to enlarge

CPTC-IL6-2 Indirect ELISA

Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding.

NCI 60 Protein Array

CPTC-IL6-2 NCI 60 Protein Array

This antibody is not suitable for use in a Reverse Phase Protein Array format as described in SOP M-105.

IHC NCI60

CPTC-IL6-2 IHC NCI60

This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.

Click to view IHC NCI60 Cell Line Array example

IHC Tissue

CPTC-IL6-2 IHC Tissue

This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.

Antibody: CPTC-IL6-3

Background

Catalog Number:
CPTC-IL6-3
Target Antigen:
Interleukin 6
Isotype:
IgG2b
Species:
Mouse
Last Updated:
11/26/2013
Antigen Recognition(s):
recombinant full-length

Purchase

Characterization Data [Compare Characterization Data]

Western Blot

Click to enlarge image Western Blot using CPTC-IL6-3 as primary Ab against IL6 (rAg 10142) in lane 2. Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).
Click to enlarge

CPTC-IL6-3 Western blot

Western Blot using CPTC-IL6-3 as primary Ab against IL6 (rAg 10142) in lane 2. Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).

Indirect ELISA

Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding.
Click to enlarge

CPTC-IL6-3 Indirect ELISA

Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding.

NCI 60 Protein Array

CPTC-IL6-3 NCI 60 Protein Array

This antibody is not suitable for use in a Reverse Phase Protein Array format as described in SOP M-105.

IHC NCI60

CPTC-IL6-3 IHC NCI60

This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.

Click to view IHC NCI60 Cell Line Array example

IHC Tissue

CPTC-IL6-3 IHC Tissue

This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.

Antigen: Interleukin 6

Background

NCI Identification Number:
10142
Antigen Name:
Interleukin 6
CPTC Name:
CPTC-IL6
Keywords:
interleukin 6; IL-6; BSF2; HGF; IFNB2; Hybridoma growth factor; Interferon beta-2; BSF-2; CDF; IFN-beta-2; B-cell stimulatory factor 2; CTL differentiation factor; OTTHUMP00000158544; OTTHUMP00000198486; OTTHUMP00000198490; B cell stimulatory factor-2; B-cell differentiation factor; interleukin BSF-2; interleukin-6
Function:
This gene encodes a cytokine that functions in inflammation and the maturation of B cells. The protein is primarily produced at sites of acute and chronic inflammation, where it is secreted into the serum and induces a transcriptional inflammatory response through interleukin 6 receptor, alpha. The functioning of this gene is implicated in a wide variety of inflammation-associated disease states, including suspectibility to diabetes mellitus and systemic juvenile
rheumatoid arthritis.

Cytokine with a wide variety of biological functions. It is a potent inducer of the acute phase response.
Plays an essential role in the final differentiation of B-cells into Ig-secreting cells Involved in lymphocyte and monocyte differentiation. It induces myeloma and plasmacytoma growth and induces nerve cells differentiation Acts on B-cells, T-cells, hepatocytes, hematopoeitic progenitor cells and cells of the CNS. Also acts as a myokine. It is discharged into the bloodstream after muscle contraction and acts to increase the breakdown of fats and to improve insulin resistance
Chromosomal Localization:
7p21-p15
Expression System:
E. Coli
NCBI Accession Number:
BC015511
Swiss Prot Accession Number:
P05231
DNA Source:
DNASU - HsCD00002062
Immunogen:
Recombinant Full Length Protein
Vector Name:
pMCSG7
Extinction Coefficient:
10095
Buffers:
PBS without Ca++ and Mg++
Expressed Sequence:
SNAPVPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDG
ISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGC
FQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQ
ARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLT
KLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM
Native Sequence:
MNSFSTSAFGPVAFSLGLLLVLPAAFPAPVPPGEDSKDVAAPH
RQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALA
ENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYL
QNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTN
ASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM
Calculated Isoelectric Point:
6.17
Molecular Weight:
21182
Last Updated:
11/14/2012

Links

Characterization Data

Gel

Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding.
Click to enlarge

CPTC-IL6 SDS PAGE

PAGE of IL6 (rAg 10142) with molecular weight standards in lane 1

SOPs

Adobe Reader™ required.

Get Adobe Reader for free at Adobe.com