Skip to Content

Interleukin 18

Antibody: CPTC-IL18-1

Background

Catalog Number:
CPTC-IL18-1
Target Antigen:
Interleukin 18
Isotype:
IgG1
Species:
Mouse
Last Updated:
12/16/2011
Antigen Recognition(s):
recombinant full-length

Purchase

External Links

Characterization Data [Compare Characterization Data]

Western Blot

Click to enlarge image Western Blot using CPTC-IL18-1 as primary Ab against Ag 10190 (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).
Click to enlarge

CPTC-IL18-1 Western Blot

Western Blot using CPTC-IL18-1 as primary Ab against Ag 10190 (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).

Indirect ELISA

Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate)
Click to enlarge

CPTC-IL18-1 Indirect ELISA

Indirect ELISA (ie, binding of Antibody to Antigen coated plate)

NCI 60 Protein Array

Click to enlarge image Protein Array in which CPTC IL-18-1 is screened against the NCI60 cell line panel for expression. Data is normalized to a mean signal of 1.0 and standard deviation of 0.5. Color conveys over-expression level (green), basal level (blue), under-expression level (red).
Click to enlarge

CPTC IL-18-1 Protein Array

Protein Array in which CPTC IL-18-1 is screened against the NCI60 cell line panel for expression. Data is normalized to a mean signal of 1.0 and standard deviation of 0.5. Color conveys over-expression level (green), basal level (blue), under-expression level (red).

IHC NCI60

Click to enlarge image Immunohistochemistry of CPTC IL-18-1 for NCI60 Cell Line Array. Data scored as:
0=NEGATIVE
1=WEAK (red)
2=MODERATE (blue)
3=STRONG (green)
Titer:1:1000
Click to enlarge

CPTC IL-18-1 IHC NCI60

Immunohistochemistry of CPTC IL-18-1 for NCI60 Cell Line Array. Data scored as:
0=NEGATIVE
1=WEAK (red)
2=MODERATE (blue)
3=STRONG (green)
Titer:1:1000

Click to view IHC NCI60 Cell Line Array example

IHC Tissue

Click to enlarge image Tissue Micro-Array(TMA) core of colon cancer showing cytoplasmic staining using Antibody CPTC IL-18-1. Titer: 1:1000
Click to enlarge

CPTC IL-18-1 IHC Tissue

Tissue Micro-Array(TMA) core of colon cancer showing cytoplasmic staining using Antibody CPTC IL-18-1. Titer: 1:1000

IHC HPA

Download IL-18-1 IHC Report.pdf (146.8 KB)

CPTC IL-18-1 HPA Evaluation

This PDF describes the results of the evaluation of this antibody by the Human Protein Atlas (www.proteinatlas.org).

Antibody: CPTC-IL18-2

Background

Catalog Number:
CPTC-IL18-2
Target Antigen:
Interleukin 18
Isotype:
IgG1
Species:
Mouse
Last Updated:
12/16/2011
Antigen Recognition(s):
recombinant full-length

Purchase

Characterization Data [Compare Characterization Data]

Western Blot

Click to enlarge image Western Blot using CPTC-IL18-2 as primary Ab against Ag 10190 (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).
Click to enlarge

CPTC-IL18-2 Western Blot

Western Blot using CPTC-IL18-2 as primary Ab against Ag 10190 (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).

Indirect ELISA

Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate)
Click to enlarge

CPTC-IL18-2 Indirect ELISA

Indirect ELISA (ie, binding of Antibody to Antigen coated plate)

NCI 60 Protein Array

Click to enlarge image Protein Array in which CPTC-IL18-2 is screened against the NCI60 cell line panel for expression. Data is normalized to a mean signal of 1.0 and standard deviation of 0.5. Color conveys over-expression level (green), basal level (blue), under-expression level (red).
Click to enlarge

CPTC-IL18-2 Protein Array

Protein Array in which CPTC-IL18-2 is screened against the NCI60 cell line panel for expression. Data is normalized to a mean signal of 1.0 and standard deviation of 0.5. Color conveys over-expression level (green), basal level (blue), under-expression level (red).

IHC NCI60

Click to enlarge image 
Immunohistochemistry of CPTC-IL18-2 for NCI60 Cell Line Array. Data scored as:
0=NEGATIVE
1=WEAK (red)
2=MODERATE (blue)
3=STRONG (green)
Titer: 1:50
Click to enlarge

CPTC-IL18-2 IHC NCI60


Immunohistochemistry of CPTC-IL18-2 for NCI60 Cell Line Array. Data scored as:
0=NEGATIVE
1=WEAK (red)
2=MODERATE (blue)
3=STRONG (green)
Titer: 1:50

Click to view IHC NCI60 Cell Line Array example

IHC HPA

Download IL-18-2 HPA Report.pdf (568.5 KB)

CPTC-IL18-2 evaluation by the Human Protein Atlas

This PDF provides the evaluation results as provided by the Human Protein Atlas (www.proteinatlas.org).

Antibody: CPTC-IL18-3

Background

Catalog Number:
CPTC-IL18-3
Target Antigen:
Interleukin 18
Isotype:
IgG2b
Species:
Mouse
Last Updated:
03/09/2013
Antigen Recognition(s):

Purchase

Characterization Data [Compare Characterization Data]

Western Blot

Click to enlarge image Western Blot using CPTC-IL18-3 as primary Ab against Ag 10190 (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).
Click to enlarge

CPTC-IL18-3 Western Blot

Western Blot using CPTC-IL18-3 as primary Ab against Ag 10190 (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).

Indirect ELISA

Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate)
Click to enlarge

CPTC-IL18-3 Indirect ELISA

Indirect ELISA (ie, binding of Antibody to Antigen coated plate)

NCI 60 Protein Array

Click to enlarge image Protein Array in which CPTC-AKR1B1-1 is screened against the NCI60 cell line panel for expression. Data is normalized to a mean signal of 1.0 and standard deviation of 0.5. Color conveys over-expression level (green), basal level (blue), under-expression level (red).
Click to enlarge

CPTC-IL18-3 NCI 60 Protein Array

Protein Array in which CPTC-AKR1B1-1 is screened against the NCI60 cell line panel for expression. Data is normalized to a mean signal of 1.0 and standard deviation of 0.5. Color conveys over-expression level (green), basal level (blue), under-expression level (red).

IHC NCI60

Click to enlarge image Immuno-histochemistry of CPTC-IL18-3 for NCI60  Cell Line Array at titer 1:3000
0=NEGATIVE
1=WEAK(red)
2=MODERATE(blue)
3=STRONG(green)
Click to enlarge

CPTC-IL18-3 IHC NCI60

Immuno-histochemistry of CPTC-IL18-3 for NCI60 Cell Line Array at titer 1:3000
0=NEGATIVE
1=WEAK(red)
2=MODERATE(blue)
3=STRONG(green)

Click to view IHC NCI60 Cell Line Array example

IHC Tissue

Click to enlarge image Tissue Micro-Array (TMA) core of breast cancer showing cytoplasmic staining using Antibody CPTC-IL18-3.
Click to enlarge

CPTC-IL18-3 IHC Tissue

Tissue Micro-Array (TMA) core of breast cancer showing cytoplasmic staining using Antibody CPTC-IL18-3.

IHC HPA

Download CPTC-IL18-3.pdf (95.9 KB)

CPTC-IL18-3

This PDF contains the evaluation results provided by the Human Protein Atlas (www.proteinatlas.org)

Antigen: Interleukin 18

Background

NCI Identification Number:
10190
Antigen Name:
Interleukin 18
CPTC Name:
CPTC-IL18
Keywords:
IL-18; IG1F; IL-1g; IL1F4; MGC12320; Interferon gamma inducing factor
Function:
Interleukin-18 (IL-18) is a cytokine produced by macrophages and other cells that belongs to the IL-1 superfamily. IL-18 works together with IL-12 to induce cell-mediated immunity following infection with microbial products like lipopolysaccharide (LPS). After stimulation with IL-18, natural killer (NK) cells and certain T cells release another important cytokine called interferon gamma or type II interferon that plays an important role in activating the macrophages or other cells. Apart from its physiological role, IL-18 is also able to induce severe inflammatory reactions, which suggests its role in certain inflammatory disorders. The protein encoded by this gene is a proinflammatory cytokine. This cytokine can induce the IFN-gamma production of T cells. The combination of this cytokine and IL12 has been shown to inhibit IL4 dependent IgE and IgG1 production, and enhance IgG2a production of B cells. IL-18 binding protein (IL18BP) can specifically interact with this cytokine, and thus negatively regulate its biological activity.
Chromosomal Localization:
11q22.2 - q22.3
Expression System:
E. Coli
NCBI Accession Number:
NM_001562
Swiss Prot Accession Number:
Q14116
DNA Source:
HIP:HsCD00000423
Immunogen:
Recombinant Full Length Protein
Vector Name:
pMCSG7
Extinction Coefficient:
7575
Buffers:
50mM NH4HC03
Expressed Sequence:
SNAMAAEPVEDNCINFVAMKFIDNTLYFIAEDDENLESDY
FGKLESKLSVIRNLNDQVLFIDQGNRPLFEDMTDSDCRDN
APRTIFIISMYKDSQPRGMAVTISVKCEKISTLSCENKII
SFKEMNPPDNIKDTKSDIIFFQRSVPGHDNKMQFESSSYE
GYFLACEKERDLFKLILKKEDELGDRSIMFTVQNED
Native Sequence:
MAAEPVEDNCINFVAMKFIDNTLYFIAEDDENLESDYFG
KLESKLSVIRNLNDQVLFIDQGNRPLFEDMTDSDCRDNA
PRTIFIISMYKDSQPRGMAVTISVKCEKISTLSCENKII
SFKEMNPPDNIKDTKSDIIFFQRSVPGHDNKMQFESSSY
EGYFLACEKERDLFKLILKKEDELGDRSIMFTVQNED
Calculated Isoelectric Point:
4.54
Molecular Weight:
22598
Last Updated:
11/14/2012

Links

Characterization Data

Gel

Click to enlarge image Tissue Micro-Array (TMA) core of breast cancer showing cytoplasmic staining using Antibody CPTC-IL18-3.
Click to enlarge

Ag 10190

PAGE of Ag 10190 with molecular weight standards

SOPs

Adobe Reader™ required.

Get Adobe Reader for free at Adobe.com