Skip to Content

Heat shock 27kDa protein 1

Antibody: CPTC-HSPB1-1

Background

Catalog Number:
CPTC-HSPB1-1
Target Antigen:
Heat shock 27kDa protein 1
Isotype:
IgG1
Species:
Mouse
Last Updated:
02/12/2014
Antigen Recognition(s):

Purchase

Characterization Data [Compare Characterization Data]

Western Blot

Click to enlarge image Western Blot using CPTC-HSPB1-1 as primary Ab against rAg 10175 (HSPB1) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG as control for goat anti-mouse HRP secondary binding (lane 3).
Click to enlarge

CPTC-HSPB1-1 Western blot

Western Blot using CPTC-HSPB1-1 as primary Ab against rAg 10175 (HSPB1) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG as control for goat anti-mouse HRP secondary binding (lane 3).

Characterization SOP Files

Cell Lysate Western Blot

Click to enlarge image Western Blot using CPTC-HSPB1-1 as primary Ab against cell lysate from transiently overexpressed HEK293T cells form Origene (lane 2). Also included are molecular wt. standards (lane 1), lysate from non-transfected HEK293T cells as neg control (lane 3) and recombinant Ag HSPB1 (NCI 10175) in (lane 4).
Click to enlarge

CPTC-HSPB1-1 Cell Lysate Western blot

Western Blot using CPTC-HSPB1-1 as primary Ab against cell lysate from transiently overexpressed HEK293T cells form Origene (lane 2). Also included are molecular wt. standards (lane 1), lysate from non-transfected HEK293T cells as neg control (lane 3) and recombinant Ag HSPB1 (NCI 10175) in (lane 4).

Indirect ELISA

Click to enlarge image Indirect ELISA (i.e., binding of Antibody to Antigen coated plate)
Click to enlarge

CPTC-HSPB1-1 Indirect ELISA

Indirect ELISA (i.e., binding of Antibody to Antigen coated plate)

Characterization SOP Files

NCI 60 Protein Array

CPTC-HSPB1-1 NCI 60 Protein Array

This antibody is not suitable for use in a Reverse Phase Protein Array format as described in SOP M-105.

IHC NCI60

CPTC-HSPB1-1 IHC NCI60

This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.

Click to view IHC NCI60 Cell Line Array example

IHC Tissue

CPTC-HSPB1-1 IHC Tissue

This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.

IHC HPA

Download CPTC-HSPB1-1.pdf (96.6 KB)

CPTC-HSPB1-1 Evaluation by the Human Protein Atlas

This PDF contains the evaluation results provided by the Human Protein Atlas (www.proteinatlas.org)

Antibody: CPTC-HSPB1-2

Background

Catalog Number:
CPTC-HSPB1-2
Target Antigen:
Heat shock 27kDa protein 1
Isotype:
IgG1
Species:
Mouse
Last Updated:
02/12/2014
Antigen Recognition(s):

External Links

Purchase

Characterization Data [Compare Characterization Data]

Western Blot

Click to enlarge image Western Blot using CPTC-HSPB1-2 as primary Ab against rAg 10175 (HSPB1) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG as control for goat anti-mouse HRP secondary binding (lane 3).
Click to enlarge

CPTC-HSPB1-2 Western blot

Western Blot using CPTC-HSPB1-2 as primary Ab against rAg 10175 (HSPB1) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG as control for goat anti-mouse HRP secondary binding (lane 3).

Characterization SOP Files

Cell Lysate Western Blot

Click to enlarge image Western Blot using CPTC-HSPB1-2 as primary Ab against cell lysate from transiently overexpressed HEK293T cells form Origene (lane 2). Also included are molecular wt. standards (lane 1), lysate from non-transfected HEK293T cells as neg control (lane 3) and recombinant Ag HSPB1 (NCI 10175) in (lane 4).
Click to enlarge

CPTC-HSPB1-2 Cell Lysate Western blot

Western Blot using CPTC-HSPB1-2 as primary Ab against cell lysate from transiently overexpressed HEK293T cells form Origene (lane 2). Also included are molecular wt. standards (lane 1), lysate from non-transfected HEK293T cells as neg control (lane 3) and recombinant Ag HSPB1 (NCI 10175) in (lane 4).

Indirect ELISA

Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate)
Click to enlarge

CPTC-HSPB1-2 Indirect ELISA

Indirect ELISA (ie, binding of Antibody to Antigen coated plate)

Characterization SOP Files

NCI 60 Protein Array

Click to enlarge image Protein Array in which CPTC-HSPB1-2 is screened against the NCI60 cell line panel for expression. Data is normalized to a mean signal of 1.0 and standard deviation of 0.5. Color conveys over-expression level (green), basal level (blue), under-expression level (red).
Click to enlarge

CPTC-HSPB1-2 Protein Array

Protein Array in which CPTC-HSPB1-2 is screened against the NCI60 cell line panel for expression. Data is normalized to a mean signal of 1.0 and standard deviation of 0.5. Color conveys over-expression level (green), basal level (blue), under-expression level (red).

IHC HPA

Download CPTC-HSPB1-2.pdf (107.6 KB)

CPTC-HSPB1-2

This PDF contains the evaluation results provided by the Human Protein Atlas (www.proteinatlas.org)

Antibody: CPTC-HSPB1-3

Background

Catalog Number:
CPTC-HSPB1-3
Target Antigen:
Heat shock 27kDa protein 1
Isotype:
IgG2b
Species:
Mouse
Last Updated:
02/12/2014
Antigen Recognition(s):

Purchase

Characterization Data [Compare Characterization Data]

Western Blot

Click to enlarge image Western Blot using CPTC-HSPB1-3 as primary Ab against rAg 10175 (HSPB1) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG as control for goat anti-mouse HRP secondary binding (lane 3).
Click to enlarge

CPTC-HSPB1-3 Western blot

Western Blot using CPTC-HSPB1-3 as primary Ab against rAg 10175 (HSPB1) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG as control for goat anti-mouse HRP secondary binding (lane 3).

Characterization SOP Files

Cell Lysate Western Blot

Click to enlarge image Western Blot using CPTC-HSPB1-3 as primary Ab against cell lysate from transiently overexpressed HEK293T cells form Origene (lane 2). Also included are molecular wt. standards (lane 1), lysate from non-transfected HEK293T cells as neg control (lane 3) and recombinant Ag HSPB1 (NCI 10175) in (lane 4).
Click to enlarge

CPTC-HSPB1-3 Cell Lysate Western blot

Western Blot using CPTC-HSPB1-3 as primary Ab against cell lysate from transiently overexpressed HEK293T cells form Origene (lane 2). Also included are molecular wt. standards (lane 1), lysate from non-transfected HEK293T cells as neg control (lane 3) and recombinant Ag HSPB1 (NCI 10175) in (lane 4).

Indirect ELISA

Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate)
Click to enlarge

CPTC-HSPB1-3 Indirect ELISA

Indirect ELISA (ie, binding of Antibody to Antigen coated plate)

Characterization SOP Files

NCI 60 Protein Array

Click to enlarge image This antibody is not suitable for use in a Reverse Phase Protein Array format as described in SOP M-105.
Click to enlarge

CPTC-HSPB1-3 NCI 60 Protein Array

This antibody is not suitable for use in a Reverse Phase Protein Array format as described in SOP M-105.

IHC NCI60

CPTC-HSPB1-3 IHC NCI60

This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.

Click to view IHC NCI60 Cell Line Array example

IHC Tissue

CPTC-HSPB1-3 IHC Tissue

This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.

IHC HPA

Download CPTC-HSPB1-3.pdf (92.8 KB)

CPTC-HSPB1-3 Evaluation by the Human Protein Atlas

This PDF contains the evaluation results provided by the Human Protein Atlas (www.proteinatlas.org)

Antigen: Heat shock 27kDa protein 1

Background

NCI Identification Number:
10175
Antigen Name:
Heat shock 27kDa protein 1
CPTC Name:
CPTC-HSPB1
Keywords:
HSPB1; CMT2F; HMN2B; DKFZp586P1322; HS.76067; HSP27; HSP28; Hsp25; HspB1; OTTHUMP00000024846; SRP27
Function:
Involved in stress resistance and actin organization
Chromosomal Localization:
7q11.23
Expression System:
E. Coli
NCBI Accession Number:
NM_001540
Swiss Prot Accession Number:
P04792
DNA Source:
HIP:HsCD00000450
Immunogen:
Recombinant Full Length Protein
Vector Name:
pMCSG7
Extinction Coefficient:
40450
Buffers:
50mM NH4HC03
Expressed Sequence:
SNAMTERRVPFSLLRGPSWDPFRDWYPHSRLFDQAFGLPRLP
EEWSQWLGGSSWPGYVRPLPPAAIESPAVAAPAYSRALSRQL
SSGVSEIRHTADRWRVSLDVNHFAPDELTVKTKDGVVEITGK
HEERQDEHGYISRCFTRKYTLPPGVDPTQVSSSLSPEGTLTV
EAPMPKLATQSNEITIPVTFESRAQLGGPEAAKSDETAAK
Native Sequence:
MTERRVPFSLLRGPSWDPFRDWYPHSRLFDQAFGLPRLPEE
WSQWLGGSSWPGYVRPLPPAAIESPAVAAPAYSRALSRQLS
SGVSEIRHTADRWRVSLDVNHFAPDELTVKTKDGVVEITGK
HEERQDEHGYISRCFTRKYTLPPGVDPTQVSSSLSPEGTLT
VEAPMPKLATQSNEITIPVTFESRAQLGGPEAAKSDETAAK
Calculated Isoelectric Point:
5.97
Molecular Weight:
23055
Last Updated:
11/14/2012

Links

Characterization Data

Gel

Click to enlarge image This antibody is not suitable for use in a Reverse Phase Protein Array format as described in SOP M-105.
Click to enlarge

Ag 10175

PAGE of Ag 10175 (with molecular weight standards in lane 1)

SOPs

Adobe Reader™ required.

Get Adobe Reader for free at Adobe.com