Skip to Content

Gelsolin

Antibody: CPTC-Gelsolin-1

Background

Catalog Number:
CPTC-Gelsolin-1
Target Antigen:
Gelsolin
Isotype:
IgG1
Species:
Mouse
Last Updated:
12/15/2011
Antigen Recognition(s):
recombinant full-length

Purchase

External Links

Characterization Data [Compare Characterization Data]

Western Blot

Click to enlarge image Western Blot using CPTC-Gelsolin-1 as primary Ab against Ag 10594 (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).
Click to enlarge

CPTC-Gelsolin-1 Western Blot

Western Blot using CPTC-Gelsolin-1 as primary Ab against Ag 10594 (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).

Indirect ELISA

Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate)
Click to enlarge

CPTC-Gelsolin-1 Indirect ELISA

Indirect ELISA (ie, binding of Antibody to Antigen coated plate)

NCI 60 Protein Array

Click to enlarge image Protein Array in which CPTC-Gelsolin-1 CPTC-AKR1B1-1 is screened against the NCI60 cell line panel for expression. Data is normalized to a mean signal of 1.0 and standard deviation of 0.5. Color conveys over-expression level (green), basal level (blue), under-expression level (red).
Click to enlarge

CPTC-Gelsolin-1 Protein Array

Protein Array in which CPTC-Gelsolin-1 CPTC-AKR1B1-1 is screened against the NCI60 cell line panel for expression. Data is normalized to a mean signal of 1.0 and standard deviation of 0.5. Color conveys over-expression level (green), basal level (blue), under-expression level (red).

Antibody: CPTC-Gelsolin-2

Background

Catalog Number:
CPTC-Gelsolin-2
Target Antigen:
Gelsolin
Isotype:
IgG1
Species:
Mouse
Last Updated:
03/13/2014
Antigen Recognition(s):
recombinant full-length

Purchase

Characterization Data [Compare Characterization Data]

Western Blot

Click to enlarge image Western Blot using CPTC-Gelsolin-2 as primary Ab against Gelsolin (rAg 10594) in lane 2. Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).
Click to enlarge

CPTC-Gelsolin-2 Western blot

Western Blot using CPTC-Gelsolin-2 as primary Ab against Gelsolin (rAg 10594) in lane 2. Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).

Cell Lysate Western Blot

Click to enlarge image Western Blot using CPTC-Gelsolin-2 as primary Ab against cell lysate from transiently overexpressed HEK293T cells form Origene (lane 3). Also included are molecular wt. standards (lane 1), lysate from non-transfected HEK293T cells as neg control (lane 4) and recombinant Ag Gelsolin (NCI 10594) in (lane 2).
Click to enlarge

CPTC-Gelsolin-2 Cell Lysate Western blot

Western Blot using CPTC-Gelsolin-2 as primary Ab against cell lysate from transiently overexpressed HEK293T cells form Origene (lane 3). Also included are molecular wt. standards (lane 1), lysate from non-transfected HEK293T cells as neg control (lane 4) and recombinant Ag Gelsolin (NCI 10594) in (lane 2).

Indirect ELISA

Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding.
Click to enlarge

CPTC-Gelsolin-2 Indirect ELISA

Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding.

NCI 60 Protein Array

CPTC-Gelsolin-2 NCI 60 Protein Array

This antibody is not suitable for use in a Reverse Phase Protein Array format as described in SOP M-105.

IHC NCI60

CPTC-Gelsolin-2 IHC NCI60

This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.

Click to view IHC NCI60 Cell Line Array example

IHC Tissue

CPTC-Gelsolin-2 IHC Tissue

This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.

SPR

Download Gelsolin pairing.pdf (769.0 KB)

SPR pairing results

This table summarizes the results of the pairing experiment with Gelsolin antibodies.

SPR

Click to enlarge image Kinetic titration data for Gelsolin-2 using Biacore SPR method
Click to enlarge

CPTC-Gelsolin-2 SPR

Kinetic titration data for Gelsolin-2 using Biacore SPR method

Antibody: CPTC-Gelsolin-3

Background

Catalog Number:
CPTC-Gelsolin-3
Target Antigen:
Gelsolin
Isotype:
IgG2b
Species:
Mouse
Last Updated:
03/13/2014
Antigen Recognition(s):
recombinant full-length

Purchase

Characterization Data [Compare Characterization Data]

Western Blot

Click to enlarge image Western Blot using CPTC-Gelsolin-3 as primary Ab against Gelsolin (rAg 10594) in lane 2. Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).
Click to enlarge

CPTC-Gelsolin-3 Western blot

Western Blot using CPTC-Gelsolin-3 as primary Ab against Gelsolin (rAg 10594) in lane 2. Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).

Cell Lysate Western Blot

Click to enlarge image Western Blot using CPTC-Gelsolin-3 as primary Ab against cell lysate from transiently overexpressed HEK293T cells form Origene (lane 3). Also included are molecular wt. standards (lane 1), lysate from non-transfected HEK293T cells as neg control (lane 4) and recombinant Ag Gelsolin (NCI 10594) in (lane 2).
Click to enlarge

CPTC-Gelsolin-3 Cell Lysate Western blot

Western Blot using CPTC-Gelsolin-3 as primary Ab against cell lysate from transiently overexpressed HEK293T cells form Origene (lane 3). Also included are molecular wt. standards (lane 1), lysate from non-transfected HEK293T cells as neg control (lane 4) and recombinant Ag Gelsolin (NCI 10594) in (lane 2).

Indirect ELISA

Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding.
Click to enlarge

CPTC-Gelsolin-3 Indirect ELISA

Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding.

NCI 60 Protein Array

CPTC-Gelsolin-3 NCI 60 Protein Array

This antibody is not suitable for use in a Reverse Phase Protein Array format as described in SOP M-105.

IHC NCI60

CPTC-Gelsolin-3 IHC NCI60

This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.

Click to view IHC NCI60 Cell Line Array example

IHC NCI60

CPTC-Gelsolin-3 IHC Tissue

This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.

Click to view IHC NCI60 Cell Line Array example

SPR

Download Gelsolin pairing.pdf (769.0 KB)

SPR pairing results

This table summarizes the results of the pairing experiment with Gelsolin antibodies.

SPR

Click to enlarge image Kinetic titration data for Gelsolin-3 antibody using Biacore SPR method
Click to enlarge

CPTC-Gelsolin-3 SPR

Kinetic titration data for Gelsolin-3 antibody using Biacore SPR method

Antibody: CPTC-Gelsolin-4

Background

Catalog Number:
CPTC-Gelsolin-4
Target Antigen:
Gelsolin
Isotype:
IgG2b
Species:
Mouse
Last Updated:
03/13/2014
Antigen Recognition(s):
recombinant full-length

Purchase

Characterization Data [Compare Characterization Data]

Western Blot

Click to enlarge image Western Blot using CPTC-Gelsolin-4 as primary Ab against Gelsolin (rAg 10594) in lane 2. Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).
Click to enlarge

CPTC-Gelsolin-4 Western blot

Western Blot using CPTC-Gelsolin-4 as primary Ab against Gelsolin (rAg 10594) in lane 2. Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).

Cell Lysate Western Blot

Click to enlarge image Western Blot using CPTC-Gelsolin-4 as primary Ab against cell lysate from transiently overexpressed HEK293T cells form Origene (lane 3). Also included are molecular wt. standards (lane 1), lysate from non-transfected HEK293T cells as neg control (lane 4) and recombinant Ag Gelsolin (NCI 10594) in (lane 2).
Click to enlarge

CPTC-Gelsolin-4 Cell Lysate Western blot

Western Blot using CPTC-Gelsolin-4 as primary Ab against cell lysate from transiently overexpressed HEK293T cells form Origene (lane 3). Also included are molecular wt. standards (lane 1), lysate from non-transfected HEK293T cells as neg control (lane 4) and recombinant Ag Gelsolin (NCI 10594) in (lane 2).

Indirect ELISA

Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding.
Click to enlarge

CPTC-Gelsolin-4 Indirect ELISA

Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding.

NCI 60 Protein Array

CPTC-Gelsolin-4 NCI 60 Protein Array

This antibody is not suitable for use in a Reverse Phase Protein Array format as described in SOP M-105.

IHC NCI60

CPTC-Gelsolin-4 IHC NCI60

This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.

Click to view IHC NCI60 Cell Line Array example

IHC Tissue

CPTC-Gelsolin-4 IHC Tissue

This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.

SPR

Download Gelsolin pairing.pdf (769.0 KB)

SPR pairing results

This table summarizes the results of the pairing experiment with Gelsolin antibodies.

SPR

Click to enlarge image Kinetic titration data for Gelsolin-4 antibody using Biacore SPR method
Click to enlarge

CPTC Gelsolin-4 SPR

Kinetic titration data for Gelsolin-4 antibody using Biacore SPR method

Antigen: Gelsolin

Background

NCI Identification Number:
10594
Antigen Name:
Gelsolin
CPTC Name:
CPTC-Gelsolin
Keywords:
amyloidosis, Finnish type; GSN; ADF; AGEL; Brevin; DKFZp313L0718; OTTHUMP00000022011; OTTHUMP00000162202
Function:
The protein encoded by this gene binds to the "plus" ends of actin monomers and filaments
to prevent monomer exchange. The encoded calcium-regulated protein functions in both assembly and disassembly of actin filaments. Defects in this gene are a cause of familial amyloidosis Finnish type (FAF). Multiple transcript variants encoding several different isoforms have been found for this gene.
Chromosomal Localization:
9q33
Expression System:
E. Coli
NCBI Accession Number:
BC026033
Swiss Prot Accession Number:
P06396
DNA Source:
HIP:HsCD00005767
Immunogen:
Recombinant Full Length Protein
Vector Name:
pMCSG7
Extinction Coefficient:
115405
Buffers:
50mM NH4HC03
Expressed Sequence:
SNAATASRGASQAGAPQGRVPEARPNSMVVEHPEFLKAGKEPGLQIWRVEKFDLVPVPTNLYGDFFTGDAYVILKT
VQLRNGNLQYDLHYWLGNECSQDESGAAAIFTVQLDDYLNGRAVQHREVQGFESATFLGYFKSGLKYKKGGVASGF
KHVVPNEVVVQRLFQVKGRRVVRATEVPVSWESFNNGDCFILDLGNNIHQWCGSNSNRYERLKATQVSKGIRDNER
SGRARVHVSEEGTEPEAMLQVLGPKPALPAGTEDTAKEDAANRKLAKLYKVSNGAGTMSVSLVADENPFAQGALKS
EDCFILDHGKDGKIFVWKGKQANTEERKAALKTASDFITKMDYPKQTQVSVLPEGGETPLFKQFFKNWRDPDQTDG
LGLSYLSSHIANVERVPFDAATLHTSTAMAAQHGMDDDGTGQKQIWRIEGSNKVPVDPATYGQFYGGDSYIILYNY
RHGGRQGQIIYNWQGAQSTQDEVAASAILTAQLDEELGGTPVQSRVVQGKEPAHLMSLFGGKPMIIYKGGTSREGG
QTAPASTRLFQVRANSAGATRAVEVLPKAGALNSNDAFVLKTPSAAYLWVGTGASEAEKTGAQELLRVLRAQPVQV
AEGSEPDGFWEALGGKAAYRTSPRLKDKKMDAHPPRLFACSNKIGRFVIEEVPGELMQEDLATDDVMLLDTWDQVF
VWVGKDSQEEEKTEALTSAKRYIETDPANRDRRTPITVVKQGFEPPSFVGWFLGWDDDYWSVDPLDRAMAELAA
Native Sequence:
MAPHRPAPALLCALSLALCALSLPVRAATASRGASQAGAPQGRVPEARPNSMVVEHPEFLKAGKEPGLQIWRVEKFDLV
PVPTNLYGDFFTGDAYVILKTVQLRNGNLQYDLHYWLGNECSQDESGAAAIFTVQLDDYLNGRAVQHREVQGFESATFL
GYFKSGLKYKKGGVASGFKHVVPNEVVVQRLFQVKGRRVVRATEVPVSWESFNNGDCFILDLGNNIHQWCGSNSNRYER
LKATQVSKGIRDNERSGRARVHVSEEGTEPEAMLQVLGPKPALPAGTEDTAKEDAANRKLAKLYKVSNGAGTMSVSLVA
DENPFAQGALKSEDCFILDHGKDGKIFVWKGKQANTEERKAALKTASDFITKMDYPKQTQVSVLPEGGETPLFKQFFKN
WRDPDQTDGLGLSYLSSHIANVERVPFDAATLHTSTAMAAQHGMDDDGTGQKQIWRIEGSNKVPVDPATYGQFYGGDSY
IILYNYRHGGRQGQIIYNWQGAQSTQDEVAASAILTAQLDEELGGTPVQSRVVQGKEPAHLMSLFGGKPMIIYKGGTSR
EGGQTAPASTRLFQVRANSAGATRAVEVLPKAGALNSNDAFVLKTPSAAYLWVGTGASEAEKTGAQELLRVLRAQPVQV
AEGSEPDGFWEALGGKAAYRTSPRLKDKKMDAHPPRLFACSNKIGRFVIEEVPGELMQEDLATDDVMLLDTWDQVFVWV
GKDSQEEEKTEALTSAKRYIETDPANRDRRTPITVVKQGFEPPSFVGWFLGWDDDYWSVDPLDRAMAELAA
Calculated Isoelectric Point:
5.71
Molecular Weight:
83231
Last Updated:
11/14/2012

Links

Characterization Data

Gel

Click to enlarge image Kinetic titration data for Gelsolin-4 antibody using Biacore SPR method
Click to enlarge

Ag 10594 PAGE

PAGE of Ag 10594 with molecular weight standards in lane 1

SOPs

Adobe Reader™ required.

Get Adobe Reader for free at Adobe.com