Skip to Content

Glutathione S Transferase Mu3

Antibody: CPTC-GSTMu3-1

Background

Catalog Number:
CPTC-GSTMu3-1
Target Antigen:
Glutathione S Transferase Mu3
Isotype:
IgG2a
Species:
Mouse
Last Updated:
06/12/2014
Antigen Recognition(s):
recombinant full-length

Purchase

External Links

Characterization Data [Compare Characterization Data]

Western Blot

Click to enlarge image Western Blot using CPTC-GSTMu3-1 as primary Ab against Ag 10080 (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).
Click to enlarge

CPTC-GSTMu3-1 Western blot

Western Blot using CPTC-GSTMu3-1 as primary Ab against Ag 10080 (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).

Indirect ELISA

Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate)
Click to enlarge

CPTC-GSTMu3-1 Indirect ELISA

Indirect ELISA (ie, binding of Antibody to Antigen coated plate)

Characterization SOP Files

Cross Reactivity Data

Click to enlarge image This table shows the cross reactivity by indirect ELISA with the GST group of antigens.
Click to enlarge

Cross Reactivity Data

This table shows the cross reactivity by indirect ELISA with the GST group of antigens.

Characterization SOP Files

NCI 60 Protein Array

CPTC-GSTMu3-1 NCI 60 Protein Array

This antibody is not suitable for use in a Reverse Phase Protein Array format as described in SOP M-105.

Antibody: CPTC-GSTMu3-2

Background

Catalog Number:
CPTC-GSTMu3-2
Target Antigen:
Glutathione S Transferase Mu3
Isotype:
IgG2b
Species:
Mouse
Last Updated:
12/16/2011
Antigen Recognition(s):
recombinant full-length

Purchase

Characterization Data [Compare Characterization Data]

Western Blot

Click to enlarge image Western Blot using CPTC-GSTMu3-2 as primary Ab against Ag 10080 (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).
Click to enlarge

CPTC-GSTMu3-2 Western blot

Western Blot using CPTC-GSTMu3-2 as primary Ab against Ag 10080 (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).

Indirect ELISA

Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate)
Click to enlarge

CPTC-GSTMu3-2 Indirect ELISA

Indirect ELISA (ie, binding of Antibody to Antigen coated plate)

Characterization SOP Files

Cross Reactivity Data

Click to enlarge image This table shows the cross reactivity by indirect ELISA with the GST group of antigens.
Click to enlarge

Cross Reactivity Data

This table shows the cross reactivity by indirect ELISA with the GST group of antigens.

Characterization SOP Files

NCI 60 Protein Array

Click to enlarge image Protein Array in which CPTC-GSTMu3-2 is screened against the NCI60 cell line panel for expression. Data is normalized to a mean signal of 1.0 and standard deviation of 0.5. Color conveys over-expression level (green), basal level (blue), under-expression level (red).
Click to enlarge

CPTC-GSTMu3-2 NCI60 Protein Array

Protein Array in which CPTC-GSTMu3-2 is screened against the NCI60 cell line panel for expression. Data is normalized to a mean signal of 1.0 and standard deviation of 0.5. Color conveys over-expression level (green), basal level (blue), under-expression level (red).

Antibody: CPTC-GSTMu3-3

Background

Catalog Number:
CPTC-GSTMu3-3
Target Antigen:
Glutathione S Transferase Mu3
Isotype:
IgG2b
Species:
Mouse
Last Updated:
06/12/2014
Antigen Recognition(s):
recombinant full-length

Purchase

Characterization Data [Compare Characterization Data]

Western Blot

Click to enlarge image Western Blot using CPTC-GSTMu3-3 as primary Ab against Ag 10080 (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).
Click to enlarge

CPTC-GSTMu3-3 Western blot

Western Blot using CPTC-GSTMu3-3 as primary Ab against Ag 10080 (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).

Indirect ELISA

Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate)
Click to enlarge

CPTC-GSTMu3-3 Indirect ELISA

Indirect ELISA (ie, binding of Antibody to Antigen coated plate)

Characterization SOP Files

Cross Reactivity Data

Click to enlarge image This table shows the cross reactivity by indirect ELISA with the GST group of antigens.
Click to enlarge

Cross Reactivity Data

This table shows the cross reactivity by indirect ELISA with the GST group of antigens.

Characterization SOP Files

NCI 60 Protein Array

CPTC-GSTMu3-3 NCI 60 Protein Array

This antibody is not suitable for use in a Reverse Phase Protein Array format as described in SOP M-105.

Antigen: Glutathione S Transferase Mu3

Background

NCI Identification Number:
10080
Antigen Name:
Glutathione S Transferase Mu3
CPTC Name:
CPTC-GSTMu3
Keywords:
GSTM3; EC 2.5.1.18; GST5; GSTB; GSTM3-3; GTM3; MGC3310; MGC3704; OTTHUMP00000013355; hGSTM3-3
Function:
Cytosolic and membrane-bound forms of glutathione S-transferase are encoded by two distinct supergene families. At present, eight distinct classes of the soluble cytoplasmic mammalian glutathione S-transferases have been identified: alpha, kappa, mu, omega, pi, sigma, theta and zeta. This gene encodes a glutathione S-transferase that belongs to the mu class. The mu class of enzymes functions in the detoxification of electrophilic compounds, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress, by conjugation with glutathione. The genes encoding the mu class of enzymes are organized in a gene cluster on chromosome 1p13.3 and are known to be highly polymorphic. These genetic variations can change an individual's susceptibility to carcinogens and toxins as well as affect the toxicity and efficacy of certain drugs. Mutations of this class mu gene have been linked with a slight increase in a number of cancers, likely due to exposure with environmental toxins. Alternative splicing results in multiple transcript variants.

Conjugation of reduced glutathione to a wide number of exogenous and endogenous hydrophobic electrophiles. May govern uptake and detoxification of both endogenous compounds and xenobiotics at the testis and brain blood barriers.
Chromosomal Localization:
1q13.3
Expression System:
E. Coli
NCBI Accession Number:
BC000088.2
Swiss Prot Accession Number:
P21266
DNA Source:
HsCD00003148
Immunogen:
Recombinant Full Length Protein
Vector Name:
pMCSG7
Extinction Coefficient:
37150
Buffers:
PBS
Expressed Sequence:
SNAMSCESSMVLGYWDIRGLAHAIRLLLEFTDTSYEEKRYTCGEAP
DYDRSQWLDVKFKLDLDFPNLPYLLDGKNKITQSNAILRYIARKHN
MCGETEEEKIRVDIIENQVMDFRTQLIRLCYSSDHEKLKPQYLEEL
PGQLKQFSMFLGKFSWFAGEKLTFVDFLTYDILDQNRIFDPKCLDE
FPNLKAFMCRFEALEKIAAYLQSDQFCKMPINNKMAQWGNKPVC
Native Sequence:
MSCESSMVLGYWDIRGLAHAIRLLLEFTDTSYEEKRYTCGEAPDY
DRSQWLDVKFKLDLDFPNLPYLLDGKNKITQSNAILRYIARKHNM
CGETEEEKIRVDIIENQVMDFRTQLIRLCYSSDHEKLKPQYLEEL
PGQLKQFSMFLGKFSWFAGEKLTFVDFLTYDILDQNRIFDPKCLD
EFPNLKAFMCRFEALEKIAAYLQSDQFCKMPINNKMAQWGNKPVC
Calculated Isoelectric Point:
5.37
Molecular Weight:
26832
Last Updated:
11/14/2012

Links

Characterization Data

SOPs

Adobe Reader™ required.

Get Adobe Reader for free at Adobe.com