Skip to Content

Glutathione S-Transferase Mu2

Antibody: CPTC-GSTMu2-1

Background

Catalog Number:
CPTC-GSTMu2-1
Target Antigen:
Glutathione S-Transferase Mu2
Isotype:
IgG2a
Species:
Mouse
Last Updated:
12/15/2011
Antigen Recognition(s):
recombinant full-length

Purchase

Characterization Data [Compare Characterization Data]

Western Blot

Click to enlarge image Western Blot using CPTC-GSTMu2-1 as primary Ab against Ag 10112 (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).
Click to enlarge

CPTC-GSTMu2-1 Western Blot

Western Blot using CPTC-GSTMu2-1 as primary Ab against Ag 10112 (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).

Indirect ELISA

Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate)
Click to enlarge

CPTC-GSTMu2-1 Indirect ELISA

Indirect ELISA (ie, binding of Antibody to Antigen coated plate)

Cross Reactivity Data

Click to enlarge image This table shows the cross reactivity by indirect ELISA with the GST group of antigens.
Click to enlarge

Cross Reactivity Data

This table shows the cross reactivity by indirect ELISA with the GST group of antigens.

Characterization SOP Files

SPR

Click to enlarge image Kinetic titration data for GSTMu2-1 Ab (623A2.1) using Biacore SPR method
Click to enlarge

CPTC-GSTMu2-1 SPR

Kinetic titration data for GSTMu2-1 Ab (623A2.1) using Biacore SPR method

Antibody: CPTC-GSTMu2-2

Background

Catalog Number:
CPTC-GSTMu2-2
Target Antigen:
Glutathione S-Transferase Mu2
Isotype:
IgG1
Species:
Mouse
Last Updated:
12/15/2011
Antigen Recognition(s):
recombinant full-length

Purchase

External Links

Characterization Data [Compare Characterization Data]

Western Blot

Click to enlarge image Western Blot using CPTC-GSTMu2-2 as primary Ab against Ag 10112 (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).
Click to enlarge

CPTC-GSTMu2-2 Western Blot

Western Blot using CPTC-GSTMu2-2 as primary Ab against Ag 10112 (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).

Indirect ELISA

Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate)
Click to enlarge

CPTC-GSTMu2-2 Indirect ELISA

Indirect ELISA (ie, binding of Antibody to Antigen coated plate)

Cross Reactivity Data

Click to enlarge image This table shows the cross reactivity by indirect ELISA with the GST group of antigens.
Click to enlarge

Cross Reactivity Data

This table shows the cross reactivity by indirect ELISA with the GST group of antigens.

Characterization SOP Files

Antibody: CPTC-GSTMu2-3

Background

Catalog Number:
CPTC-GSTMu2-3
Target Antigen:
Glutathione S-Transferase Mu2
Isotype:
IgG1
Species:
Mouse
Last Updated:
12/15/2011
Antigen Recognition(s):
recombinant full-length

Purchase

Characterization Data [Compare Characterization Data]

Western Blot

Click to enlarge image Western Blot using CPTC-GSTMu2-3 as primary Ab against Ag 10112 (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).
Click to enlarge

CPTC-GSTMu2-3 Western Blot

Western Blot using CPTC-GSTMu2-3 as primary Ab against Ag 10112 (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).

Indirect ELISA

Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate)
Click to enlarge

CPTC-GSTMu2-3 Indirect ELISA

Indirect ELISA (ie, binding of Antibody to Antigen coated plate)

Cross Reactivity Data

Click to enlarge image This table shows the cross reactivity by indirect ELISA with the GST group of antigens.
Click to enlarge

Cross Reactivity Data

This table shows the cross reactivity by indirect ELISA with the GST group of antigens.

Characterization SOP Files

Antigen: Glutathione S-Transferase Mu2

Background

NCI Identification Number:
10112
Antigen Name:
Glutathione S-Transferase Mu2
CPTC Name:
CPTC-GSTMu2
Keywords:
GSTM2; EC 2.5.1.18; GST4; GSTM; GSTM2-2; GTHMUS; MGC117303; OTTHUMP00000013351
Function:
Conjugation of reduced glutathione to a wide number of exogenous and endogenous hydrophobic electrophiles
Chromosomal Localization:
1p13.3
Expression System:
E. Coli
NCBI Accession Number:
NM_000848
Swiss Prot Accession Number:
P28161
DNA Source:
HIP:HsCD00000624
Immunogen:
Recombinant Full Length Protein
Vector Name:
pMCSG7
Extinction Coefficient:
39943
Buffers:
50mM NH4HC03
Expressed Sequence:
SNAMPMTLGYWNIRGLAHSIRLLLEYTDSSYEEKKYTMGDAPDYD
RSQWLNEKFKLGLDFPNLPYLIDGTHKITQSNAILRYIARKHNLC
GESEKEQIREDILENQFMDSRMQLAKLCYDPDFEKLKPEYLQALP
EMLKLYSQFLGKQPWFLGDKITFVDFIAYDVLERNQVFEPSCLDA
FPNLKDFISRFEGLEKISAYMKSSRFLPRPVFTKMAVWGNK
Native Sequence:
MPMTLGYWNIRGLAHSIRLLLEYTDSSYEEKKYTMGDAPDYDRS
QWLNEKFKLGLDFPNLPYLIDGTHKITQSNAILRYIARKHNLCG
ESEKEQIREDILENQFMDSRMQLAKLCYDPDFEKLKPEYLQALP
EMLKLYSQFLGKQPWFLGDKITFVDFIAYDVLERNQVFEPSCLD
AFPNLKDFISRFEGLEKISAYMKSSRFLPRPVFTKMAVWGNK
Calculated Isoelectric Point:
5.99
Molecular Weight:
26017
Last Updated:
11/14/2012

Links

Characterization Data

Gel

Click to enlarge image This table shows the cross reactivity by indirect ELISA with the GST group of antigens.
Click to enlarge

CPTC-GSTMu2

PAGE of Ag 10112 (with molecular weight standards in lane 1)

SOPs

Adobe Reader™ required.

Get Adobe Reader for free at Adobe.com