Skip to Content

Glucose phosphate isomerase

Antibody: CPTC-GPI-1

Background

Catalog Number:
CPTC-GPI-1
Target Antigen:
Glucose phosphate isomerase
Isotype:
IgG2a
Species:
Mouse
Last Updated:
12/15/2011
Antigen Recognition(s):
recombinant full-length

Purchase

External Links

Characterization Data [Compare Characterization Data]

Western Blot

Click to enlarge image Western Blot using CPTC-GPI-1 as primary Ab against Ag 10078 (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).
Click to enlarge

CPTC-GPI-1 Western Blot

Western Blot using CPTC-GPI-1 as primary Ab against Ag 10078 (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).

Indirect ELISA

Click to enlarge image Indirect ELISA of CPTC-GPI-1
Click to enlarge

CPTC-GPI-1 Indirect ELISA

Indirect ELISA of CPTC-GPI-1

Characterization SOP Files

Antibody: CPTC-GPI-2

Background

Catalog Number:
CPTC-GPI-2
Target Antigen:
Glucose phosphate isomerase
Isotype:
IgG1
Species:
Mouse
Last Updated:
03/07/2013
Antigen Recognition(s):
recombinant full-length

Purchase

Characterization Data [Compare Characterization Data]

Western Blot

Click to enlarge image Western Blot using CPTC-GPI-2 as primary Ab against Ag 10078 (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).
Click to enlarge

CPTC-GPI-2 Western Blot

Western Blot using CPTC-GPI-2 as primary Ab against Ag 10078 (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).

Indirect ELISA

Click to enlarge image Indirect ELISA of CPTC-GPI-2
Click to enlarge

CPTC-GPI-2 Indirect ELISA

Indirect ELISA of CPTC-GPI-2

Characterization SOP Files

NCI 60 Protein Array

Click to enlarge image Protein Array in which CPTC-GPI-2 is screened against the NCI60 cell line panel for expression. Data is normalized to a mean signal of 1.0 and standard deviation of 0.5. Color conveys over-expression level (green), basal level (blue), under-expression level (red).
Click to enlarge

CPTC-GPI-2 NCI 60 Protein Array

Protein Array in which CPTC-GPI-2 is screened against the NCI60 cell line panel for expression. Data is normalized to a mean signal of 1.0 and standard deviation of 0.5. Color conveys over-expression level (green), basal level (blue), under-expression level (red).

IHC NCI60

CPTC-GPI-2 IHC NCI60

This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.

Click to view IHC NCI60 Cell Line Array example
Array

IHC Tissue

CPTC-GPI-2 IHC Tissue

This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.

NAPPA

Download GPI-2 pos.pdf (1.0 MB)

Evaluation of antibody by NAPPA

This file shows the reactivity of the antibody with proteins expressed by the NAPPA technique.

Characterization SOP Files

Antibody: CPTC-GPI-3

Background

Catalog Number:
CPTC-GPI-3
Target Antigen:
Glucose phosphate isomerase
Isotype:
IgG1
Species:
Mouse
Last Updated:
03/07/2013
Antigen Recognition(s):
recombinant full-length

Purchase

Characterization Data [Compare Characterization Data]

Western Blot

Click to enlarge image Western Blot using CPTC-GPI-3 as primary Ab against Ag 10078 (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).
Click to enlarge

CPTC-GPI-3 Western Blot

Western Blot using CPTC-GPI-3 as primary Ab against Ag 10078 (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).

Indirect ELISA

Click to enlarge image Indirect ELISA of CPTC-GPI-3
Click to enlarge

CPTC-GPI-3 Indirect ELISA

Indirect ELISA of CPTC-GPI-3

Characterization SOP Files

NCI 60 Protein Array

CPTC-GPI-3 NCI 60 Protein Array

This antibody is not suitable for use in a Reverse Phase Protein Array format as described in SOP M-105.

IHC NCI60

CPTC-GPI-3 IHC NCI60

This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.

Click to view IHC NCI60 Cell Line Array example
Array

IHC Tissue

CPTC-GPI-3 IHC Tissue

This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.

NAPPA

Download GPI-3 pos.pdf (979.4 KB)

Evaluation of antibody by NAPPA

This file shows the reactivity of the antibody with proteins expressed by the NAPPA technique.

Characterization SOP Files

Antigen: Glucose phosphate isomerase

Background

NCI Identification Number:
10078
Antigen Name:
Glucose phosphate isomerase
CPTC Name:
CPTC-GPI
Keywords:
GPI; AMF; GNPI; NLK; Neuroleukin; PGI; PHI; SA-36; oxoisomerase; phosphohexomutase; phosphosaccharomutase; EC 5.3.1.9
Function:
This gene belongs to the GPI family whose members encode multifunctional phosphoglucose isomerase proteins involved in energy pathways. The protein encoded by this gene is a dimeric enzyme that catalyzes the reversible isomerization of glucose-6-phosphate and fructose-6-phosphate. The protein functions in different capacities inside and outside the cell. In the cytoplasm, the gene product is involved in glycolysis and gluconeogenesis, while outside the cell it functions as a neurotrophic factor for spinal and sensory neurons. Defects in this gene are the cause of nonspherocytic hemolytic anemia and a severe enzyme deficiency can be associated with hydrops fetalis, immediate neonatal death and neurological impairment.

Neuroleukin is a neurotrophic factor for spinal and sensory neurons.
Chromosomal Localization:
19q13.1
Expression System:
E. Coli
NCBI Accession Number:
BC004982
Swiss Prot Accession Number:
P06744
DNA Source:
HIP : HsCD00003344
Immunogen:
Recombinant Full Length Protein
Vector Name:
pMCSG7
Extinction Coefficient:
86985
Buffers:
50mM NH4HC03
Expressed Sequence:
SNAMAALTRDPQFQKLQQWYREHRSELNLRRLFDANKDRFNHFSLTLNTNHGHILVDYSKNLV
TEDVMRMLVDLAKSRGVEAARERMFNGEKINYTEGRAVLHVALRNRSNTPILVDGKDVMPEVN
KVLDKMKSFCQRVRSGDWKGYTGKTITDVINIGIGGSDLGPLMVTEALKPYSSGGPRVWYVSN
IDGTHIAKTLAQLNPESSLFIIASKTFTTQETITNAETAKEWFLQAAKDPSAVAKHFVALSTN
TTKVKEFGIDPQNMFEFWDWVGGRYSLWSAIGLSIALHVGFDNFEQLLSGAHWMDQHFRTTPL
EKNAPVLLALLGIWYINCFGCETHAMLPYDQYLHRFAAYFQQGDMESNGKYITKSGTRVDHQT
GPIVWGEPGTNGQHAFYQLIHQGTKMIPCDFLIPVQTQHPIRKGLHHKILLANFLAQTEALMR
GKSTEEARKELQAAGKSPEDLERLLPHKVFEGNRPTNSIVFTKLTPFMLGALVAMYEHKIFVQ
GIIWDINSFDQWGVELGKQLAKKIEPELDGSAQVTSHDASTNGLINFIKQQREARVQ
Native Sequence:
MAALTRDPQFQKLQQWYREHRSELNLRRLFDANKDRFNHFSLTLNTNHGHILVDYSKNLVTE
DVMRMLVDLAKSRGVEAARERMFNGEKINYTEGRAVLHVALRNRSNTPILVDGKDVMPEVNK
VLDKMKSFCQRVRSGDWKGYTGKTITDVINIGIGGSDLGPLMVTEALKPYSSGGPRVWYVSN
IDGTHIAKTLAQLNPESSLFIIASKTFTTQETITNAETAKEWFLQAAKDPSAVAKHFVALST
NTTKVKEFGIDPQNMFEFWDWVGGRYSLWSAIGLSIALHVGFDNFEQLLSGAHWMDQHFRTT
PLEKNAPVLLALLGIWYINCFGCETHAMLPYDQYLHRFAAYFQQGDMESNGKYITKSGTRVD
HQTGPIVWGEPGTNGQHAFYQLIHQGTKMIPCDFLIPVQTQHPIRKGLHHKILLANFLAQTE
ALMRGKSTEEARKELQAAGKSPEDLERLLPHKVFEGNRPTNSIVFTKLTPFMLGALVAMYEH
KIFVQGIIWDINSFDQWGVELGKQLAKKIEPELDGSAQVTSHDASTNGLINFIKQQREARVQ
Calculated Isoelectric Point:
8.42
Molecular Weight:
63419
Last Updated:
11/14/2012

Links

Characterization Data

Gel

Click to enlarge image Indirect ELISA of CPTC-GPI-3
Click to enlarge

CPTC-GPI PAGE

PAGE of Ag 10078 (with molecular weight standards in lane 1)

SOPs

Adobe Reader™ required.

Get Adobe Reader for free at Adobe.com