Skip to Content

Geminin

Antibody: CPTC-GMNN-1

Background

Catalog Number:
CPTC-GMNN-1
Target Antigen:
Geminin
Isotype:
IgG1
Species:
Mouse
Last Updated:
02/26/2013
Antigen Recognition(s):

Purchase

Characterization Data [Compare Characterization Data]

Western Blot

CPTC-GMNN-1 Western blot

Western Blot using CPTC-GMNN-1 as primary Ab against GMNN (Ag 10987) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).

Indirect ELISA

CPTC-GMNN-1 Indirect ELISA

Indirect ELISA (ie, binding of Antibody to Antigen coated plate)

NCI 60 Protein Array

CPTC-GMNN-1 NCI 60 Protein Array

This antibody is not suitable for use in a Reverse Phase Protein Array format as described in SOP M-105.

IHC NCI60

CPTC-GMNN-1 IHC NCI60

This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.

Click to view IHC NCI60 Cell Line Array example

IHC Tissue

CPTC-GMNN-1 IHC Tissue

This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.

IHC HPA

Download CPTC-GMNN-1.pdf (109.2 KB)

CPTC-GMNN-1 Evaluation by the Human Protein Atlas

This PDF contains the evaluation results provided by the Human Protein Atlas (www.proteinatlas.org)

Antibody: CPTC-GMNN-2

Background

Catalog Number:
CPTC-GMNN-2
Target Antigen:
Geminin
Isotype:
IgG1
Species:
Mouse
Last Updated:
02/19/2013
Antigen Recognition(s):

Purchase

External Links

Characterization Data [Compare Characterization Data]

Western Blot

CPTC-GMNN-2 Western blot

Western Blot using CPTC-GMNN-2 as primary Ab against GMNN (Ag 10987) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).

Indirect ELISA

CPTC-GMNN-2 Indirect ELISA

Indirect ELISA (ie, binding of Antibody to Antigen coated plate)

IHC Tissue

Click to enlarge image Tissue Micro-Array(TMA) core of lung cancer  showing nuclear staining using Antibody CPTC-GMNN-2. Titer: 1:800
Click to enlarge

CPTC-GMNN-2 IHC Tissue

Tissue Micro-Array(TMA) core of lung cancer showing nuclear staining using Antibody CPTC-GMNN-2. Titer: 1:800

IHC HPA

Download CPTC-GMNN-2.pdf (98.1 KB)

CPTC-GMNN-2 Evaluation by

This PDF contains the evaluation results provided by the Human Protein Atlas (www.proteinatlas.org)

Antibody: CPTC-GMNN-3

Background

Catalog Number:
CPTC-GMNN-3
Target Antigen:
Geminin
Isotype:
IgG2b
Species:
Mouse
Last Updated:
02/26/2013
Antigen Recognition(s):

Purchase

Characterization Data [Compare Characterization Data]

Western Blot

CPTC-GMNN-3 Western blot

Western Blot using CPTC-GMNN-3 as primary Ab against GMNN (Ag 10987) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).

Indirect ELISA

CPTC-GMNN-3 Indirect ELISA

Indirect ELISA (ie, binding of Antibody to Antigen coated plate)

NCI 60 Protein Array

CPTC-GMNN-3 NCI 60 Protein Array

This antibody is not suitable for use in a Reverse Phase Protein Array format as described in SOP M-105.

IHC NCI60

CPTC-GMNN-3 IHC NCI60

This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.

Click to view IHC NCI60 Cell Line Array example

IHC Tissue

CPTC-GMNN-3 IHC Tissue

This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.

IHC HPA

Download CPTC-GMNN-3.pdf (95.7 KB)

CPTC-GMNN-3 Evaluation by the Human Protein Atlas

This PDF contains the evaluation results provided by the Human Protein Atlas (www.proteinatlas.org)

Antigen: Geminin

Background

NCI Identification Number:
10987
Antigen Name:
Geminin
CPTC Name:
CPTC-GMNN
Keywords:
Gem; OTTHUMP00000039393; RP3-369A17.3; geminin
Function:
Inhibits DNA replication by preventing the incorporation of MCM complex into prereplication complex (pre-RC). It is degraded during the mitotic phase of the cell cycle. Its destruction at the metaphase-anaphase transition permits replication in the succeeding cell cycle.
Chromosomal Localization:
6p22.2
Expression System:
E. Coli
NCBI Accession Number:
BC005185.1
Swiss Prot Accession Number:
O75496
DNA Source:
OB : MHS1011-62496
Immunogen:
Recombinant Full Length Protein
Vector Name:
pMCSG7
Extinction Coefficient:
10033
Buffers:
PBS
Expressed Sequence:
SNAMNPSMKQKQEEIKENIKNSSVPRRTLKMIQPSASGSLVGR
ENELSAGLSKRKHRNDHLTSTTSSPGVIVPESSENKNLGGVTQ
ESFDLMIKENPSSQYWKEVAEKRRKALYEALKENEKLHKEIEQ
KDNEIARLKKENKELAEVAEHVQYMAELIERLNGEPLDNFESL
DNQEFDSEEETVEDSLVEDSEIGTCAEGTVSSSTDAKPCI
Native Sequence:
MNPSMKQKQEEIKENIKNSSVPRRTLKMIQPSASGSLVGREN
ELSAGLSKRKHRNDHLTSTTSSPGVIVPESSENKNLGGVTQE
SFDLMIKENPSSQYWKEVAEKRRKALYEALKENEKLHKEIEQ
KDNEIARLKKENKELAEVAEHVQYMAELIERLNGEPLDNFES
LDNQEFDSEEETVEDSLVEDSEIGTCAEGTVSSSTDAKPCI
Calculated Isoelectric Point:
4.93
Molecular Weight:
23.57
Last Updated:
11/14/2012

Links

Characterization Data

Gel

Click to enlarge image Tissue Micro-Array(TMA) core of lung cancer  showing nuclear staining using Antibody CPTC-GMNN-2. Titer: 1:800
Click to enlarge

CPTC-GMNN PAGE

PAGE of Ag 10987 (with molecular weight standards in lane 1)

SOPs

Adobe Reader™ required.

Get Adobe Reader for free at Adobe.com