Skip to Content

Glutamate-Cysteine Ligase Regulatory Subunit

Antibody: CPTC-GCLM-1

Background

Catalog Number:
CPTC-GCLM-1
Target Antigen:
Glutamate-Cysteine Ligase Regulatory Subunit
Isotype:
IgG2a
Species:
Mouse
Last Updated:
12/15/2011
Antigen Recognition(s):
recombinant full-length

Purchase

External Links

Characterization Data [Compare Characterization Data]

Western Blot

Click to enlarge image Western Blot Using CPTC-GCLM-1 as primary Ab against GCLM (Ag 10466)(Lane 2). Also included are Molecular Weight markers (Lane 1) and mouse IgG positive control (Lane 3).
Click to enlarge

CPTC-GCLM-1 Western Blot

Western Blot Using CPTC-GCLM-1 as primary Ab against GCLM (Ag 10466)(Lane 2). Also included are Molecular Weight markers (Lane 1) and mouse IgG positive control (Lane 3).

Indirect ELISA

Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate)
Click to enlarge

CPTC-GCLM-1 Indirect ELISA

Indirect ELISA (ie, binding of Antibody to Antigen coated plate)

Antibody: CPTC-GCLM-2

Background

Catalog Number:
CPTC-GCLM-2
Target Antigen:
Glutamate-Cysteine Ligase Regulatory Subunit
Isotype:
IgG2a
Species:
Mouse
Last Updated:
12/15/2011
Antigen Recognition(s):
recombinant full-length

Purchase

Characterization Data [Compare Characterization Data]

Western Blot

Click to enlarge image Western Blot Using CPTC-GCLM-2 as primary Ab against GCLM (Ag 10466)(Lane 2). Also included are Molecular Weight markers (Lane 1) and mouse IgG positive control (Lane 3).
Click to enlarge

CPTC-GCLM-2 Western Blot

Western Blot Using CPTC-GCLM-2 as primary Ab against GCLM (Ag 10466)(Lane 2). Also included are Molecular Weight markers (Lane 1) and mouse IgG positive control (Lane 3).

Indirect ELISA

Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate)
Click to enlarge

CPTC-GCLM -2 Indirect ELISA

Indirect ELISA (ie, binding of Antibody to Antigen coated plate)

NCI 60 Protein Array

Click to enlarge image Protein Array in which CPTC-GCLM-2  is screened against the NCI60 cell line panel for expression. Data is normalized to a mean signal of 1.0 and standard deviation of 0.5. Color conveys over-expression level (green), basal level (blue), under-expression level (red).
Click to enlarge

CPTC-GCLM-2 Protein Array

Protein Array in which CPTC-GCLM-2 is screened against the NCI60 cell line panel for expression. Data is normalized to a mean signal of 1.0 and standard deviation of 0.5. Color conveys over-expression level (green), basal level (blue), under-expression level (red).

IHC NCI60

Click to enlarge image Immunohistochemistry of CPTC-GCLM-2 for NCI60 Cell Line Array. Data scored as:
0=NEGATIVE
1=WEAK (red)
2=MODERATE (blue)
3=STRONG (green)
Titer: 1:100
Click to enlarge

CPTC-GCLM-2 IHC NCI60

Immunohistochemistry of CPTC-GCLM-2 for NCI60 Cell Line Array. Data scored as:
0=NEGATIVE
1=WEAK (red)
2=MODERATE (blue)
3=STRONG (green)
Titer: 1:100

Click to view IHC NCI60 Cell Line Array example

IHC Tissue

Click to enlarge image Tissue Micro-Array(TMA) core of colon cancer showing cytoplasmic staining using Antibody CPTC-GCLM-2. Titer: 1:100
Click to enlarge

CPTC-GCLM-2 IHC Tissue

Tissue Micro-Array(TMA) core of colon cancer showing cytoplasmic staining using Antibody CPTC-GCLM-2. Titer: 1:100

Antibody: CPTC-GCLM-3

Background

Catalog Number:
CPTC-GCLM-3
Target Antigen:
Glutamate-Cysteine Ligase Regulatory Subunit
Isotype:
IgG2a
Species:
Mouse
Last Updated:
02/28/2013
Antigen Recognition(s):

Purchase

Characterization Data [Compare Characterization Data]

Western Blot

Click to enlarge image Western Blot Using CPTC-GCLM-3 as primary Ab against GCLM (Ag 10466)(Lane 2). Also included are Molecular Weight markers (Lane 1) and mouse IgG positive control (Lane 3).
Click to enlarge

CPTC-GCLM-3 Western blot

Western Blot Using CPTC-GCLM-3 as primary Ab against GCLM (Ag 10466)(Lane 2). Also included are Molecular Weight markers (Lane 1) and mouse IgG positive control (Lane 3).

Indirect ELISA

Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate)
Click to enlarge

CPTC-GCLM -3 Indirect ELISA

Indirect ELISA (ie, binding of Antibody to Antigen coated plate)

NCI 60 Protein Array

Click to enlarge image Protein Array in which CPTC-GCLM-3 is screened against the NCI60 cell line panel for expression. Data is normalized to a mean signal of 1.0 and standard deviation of 0.5.
Click to enlarge

CPTC-GCLM-3 NCI60 Protein Array

Protein Array in which CPTC-GCLM-3 is screened against the NCI60 cell line panel for expression. Data is normalized to a mean signal of 1.0 and standard deviation of 0.5.

IHC NCI60

Click to enlarge image Immuno-histochemistry of CPTC-GCLM-3 for NCI60  Cell Line Array with titer of 1:5000
0=NEGATIVE
1=WEAK(red)
2=MODERATE(blue)
3=STRONG(green)
Click to enlarge

CPTC-GCLM-3 IHC NCI60

Immuno-histochemistry of CPTC-GCLM-3 for NCI60 Cell Line Array with titer of 1:5000
0=NEGATIVE
1=WEAK(red)
2=MODERATE(blue)
3=STRONG(green)

Click to view IHC NCI60 Cell Line Array example

IHC Tissue

CPTC-GCLM-3 IHC Tissue

Tissue Micro-Array(TMA) core of colon cancer showing cytoplasmic staining using Antibody CPTC-GCLM-3. Titer: 1:5000

Antigen: Glutamate-Cysteine Ligase Regulatory Subunit

Background

NCI Identification Number:
10466
Antigen Name:
Glutamate-Cysteine Ligase Regulatory Subunit
CPTC Name:
CPTC-GCLM
Keywords:
GCLM; GLCLR; OTTHUMP00000012299
Function:
Glutamate-cysteine ligase, also known as gamma-glutamylcysteine synthetase, is the first rate limiting enzyme of glutathione synthesis. The enzyme consists of two subunits, a heavy catalytic subunit and a light regulatory subunit. Gamma glutamylcysteine synthetase deficiency has been implicated in some forms of hemolytic anemia.
Chromosomal Localization:
1p22.1
Expression System:
E. Coli
NCBI Accession Number:
BC041809
Swiss Prot Accession Number:
P48507
DNA Source:
HIP:HsCD00005436
Immunogen:
Recombinant Full Length Protein
Vector Name:
pMCSG7
Extinction Coefficient:
39148
Buffers:
50mM NH4HC03
Expressed Sequence:
SNAMGTDSRAAKALLARARTLHLQTGNLLNWGRLRKKCPSTHSEELHDCIQKTLNE
WSSQINPDLVREFPDVLECTVSHAVEKINPDEREEMKVSAKLFIVESNSSSSTRSA
VDMACSVLGVAQLDSVIIASPPIEDGVNLSLEHLQPYWEELENLVQSKKIVAIGTS
DLDKTQLEQLYQWAQVKPNSNQVNLASCCVMPPDLTAFAKQFDIQLLTHNDPKELL
SEASFQEALQESIPDIQAHEWVPLWLLRYSVIVKSRGIIKSKGYILQAKRRGS
Native Sequence:
MGTDSRAAKALLARARTLHLQTGNLLNWGRLRKKCPSTHSEELHDCIQKTLNEWS
SQINPDLVREFPDVLECTVSHAVEKINPDEREEMKVSAKLFIVESNSSSSTRSAV
DMACSVLGVAQLDSVIIASPPIEDGVNLSLEHLQPYWEELENLVQSKKIVAIGTS
DLDKTQLEQLYQWAQVKPNSNQVNLASCCVMPPDLTAFAKQFDIQLLTHNDPKEL
LSEASFQEALQESIPDIQAHEWVPLWLLRYSVIVKSRGIIKSKGYILQAKRRGS
Calculated Isoelectric Point:
5.69
Molecular Weight:
30999
Last Updated:
04/09/2013

Links

Characterization Data

Gel

Click to enlarge image Immuno-histochemistry of CPTC-GCLM-3 for NCI60  Cell Line Array with titer of 1:5000
0=NEGATIVE
1=WEAK(red)
2=MODERATE(blue)
3=STRONG(green)
Click to enlarge

CPTC-GCLM (rAg 10466) PAGE

PAGE of GCLM (rAg 10466) with molecular weight standards in lane 1.

SOPs

Adobe Reader™ required.

Get Adobe Reader for free at Adobe.com