Skip to Content

Fas (TNFRSF6) associated factor 1

Antibody: CPTC-FAF1-1

Background

Catalog Number:
CPTC-FAF1-1
Target Antigen:
Fas (TNFRSF6) associated factor 1
Isotype:
IgG1
Species:
Mouse
Last Updated:
11/26/2013
Antigen Recognition(s):
recombinant full-length

Purchase

Characterization Data [Compare Characterization Data]

Western Blot

Click to enlarge image Western Blot using CPTC-FAF1-1 as primary Ab against FAF1 (rAg 10820) in lane 2. Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).
Click to enlarge

CPTC-FAF1-1 Western blot

Western Blot using CPTC-FAF1-1 as primary Ab against FAF1 (rAg 10820) in lane 2. Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).

Indirect ELISA

Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding.
Click to enlarge

CPTC-FAF1-1 Indirect ELISA

Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding.

NCI 60 Protein Array

CPTC-FAF1-1 NCI 60 Protein Array

This antibody is not suitable for use in a Reverse Phase Protein Array format as described in SOP M-105.

IHC NCI60

CPTC-FAF1-1 IHC NCI60

This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.

Click to view IHC NCI60 Cell Line Array example

IHC Tissue

CPTC-FAF1-1 IHC Tissue

This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.

Antibody: CPTC-FAF1-2

Background

Catalog Number:
CPTC-FAF1-2
Target Antigen:
Fas (TNFRSF6) associated factor 1
Isotype:
IgG2b
Species:
Mouse
Last Updated:
11/26/2013
Antigen Recognition(s):

Purchase

Characterization Data [Compare Characterization Data]

Western Blot

Click to enlarge image Western Blot using CPTC-FAF1-2 as primary Ab against FAF1 (rAg 10820) in lane 2. Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).
Click to enlarge

CPTC-FAF1-2 Western blot

Western Blot using CPTC-FAF1-2 as primary Ab against FAF1 (rAg 10820) in lane 2. Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).

Indirect ELISA

Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding.
Click to enlarge

CPTC-FAF1-2 Indirect ELISA

Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding.

NCI 60 Protein Array

Click to enlarge image Protein Array in which CPTC-FAF1-2 is screened against the NCI60 cell line panel for expression. Data is normalized to a mean signal of 1.0 and standard deviation of 0.5. Color conveys over-expression level (green), basal level (blue), under-expression level (red).
Click to enlarge

CPTC-FAF1-2 NCI 60 Protein Array

Protein Array in which CPTC-FAF1-2 is screened against the NCI60 cell line panel for expression. Data is normalized to a mean signal of 1.0 and standard deviation of 0.5. Color conveys over-expression level (green), basal level (blue), under-expression level (red).

IHC Tissue

Click to enlarge image Tissue Micro-Array(TMA) core of breast cancer  showing cytoplasmic staining using Antibody CPTC-FAF1-2. Titer: 1:100
Click to enlarge

CPTC-FAF1-2 IHC Tissue

Tissue Micro-Array(TMA) core of breast cancer showing cytoplasmic staining using Antibody CPTC-FAF1-2. Titer: 1:100

Antibody: CPTC-FAF1-3

Background

Catalog Number:
CPTC-FAF1-3
Target Antigen:
Fas (TNFRSF6) associated factor 1
Isotype:
IgG1
Species:
Mouse
Last Updated:
11/26/2013
Antigen Recognition(s):
recombinant full-length

Purchase

Characterization Data [Compare Characterization Data]

Western Blot

Click to enlarge image Western Blot using CPTC-FAF1-3 as primary Ab against FAF1 (rAg 10820) in lane 2. Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).
Click to enlarge

CPTC-FAF1-3 Western blot

Western Blot using CPTC-FAF1-3 as primary Ab against FAF1 (rAg 10820) in lane 2. Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).

Indirect ELISA

Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding.
Click to enlarge

CPTC-FAF1-3 Indirect ELISA

Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding.

NCI 60 Protein Array

CPTC-FAF1-3 NCI 60 Protein Array

This antibody is not suitable for use in a Reverse Phase Protein Array format as described in SOP M-105.

IHC NCI60

CPTC-FAF1-3 IHC NCI60

This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.

Click to view IHC NCI60 Cell Line Array example

IHC Tissue

CPTC-FAF1-3 IHC Tissue

This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.

Antigen: Fas (TNFRSF6) associated factor 1

Background

NCI Identification Number:
10820
Antigen Name:
Fas (TNFRSF6) associated factor 1
CPTC Name:
CPTC-FAF1
Keywords:
CGI-03; FLJ37524; HFAF1s; UBXD12; UBXN3A; hFAF1
Function:
Interaction of Fas ligand (TNFSF6) with the FAS antigen (TNFRSF6) mediates programmed cell death, also called apoptosis, in a number of organ systems. The protein encoded by this gene binds to FAS antigen and can initiate apoptosis or enhance apoptosis initiated through FAS antigen. Initiation of apoptosis by the protein encoded by this gene requires a ubiquitin-like domain but not the FAS-binding domain.

Potentiates but cannot initiate FAS-induced apoptosis.
Chromosomal Localization:
1p33
Expression System:
E. Coli
NCBI Accession Number:
BC004970.1
Swiss Prot Accession Number:
Q9UNN5
DNA Source:
HIP : HsCD00041927
Immunogen:
Recombinant Full Length Protein
Vector Name:
pMCSG7
Extinction Coefficient:
56630
Buffers:
PBS
Expressed Sequence:
SNAMASNMDREMILADFQACTGIENIDEAITLLEQNNWDLVAAINGVIPQENGILQSEYGGETIPG
PAFNPASHPASAPTSSSSSAFRPVMPSRQIVERQPRMLDFRVEYRDRNVDVVLEDTCTVGEIKQIL
ENELQIPVSKMLLKGWKTGDVEDSTVLKSLHLPKNNSLYVLTPDLPPPSSSSHAGALQESLNQNFM
LIITHREVQREYNLNFSGSSTIQEVKRNVYDLTSIPVRHQLWEGWPTSATDDSMCLAESGLSYPCH
RLTVGRRSSPAQTREQSEEQITDVHMVSDSDGDDFEDATEFGVDDGEVFGMASSALRKSPMMPENA
ENEGDALLQFTAEFSSRYGDCHPVFFIGSLEAAFQEAFYVKARDRKLLAIYLHHDESVLTNVFCSQ
MLCAESIVSYLSQNFITWAWDLTKDSNRARFLTMCNRHFGSVVAQTIRTQKTDQFPLFLIIMGKRS
SNEVLNVIQGNTTVDELMMRLMAAMEIFTAQQQEDIKDEDEREARENVKREQDEAYRLSLEADRAK
REAHEREMAEQFRLEQIRKEQEEEREAIRLSLEQALPPEPKEENAEPVSKLRIRTPSGEFLERRFL
ASNKLQIVFDFVASKGFPWDEYKLLSTFPRRDVTQLDPNKSLLEVKLFPQETLFLEAKE
Native Sequence:
MASNMDREMILADFQACTGIENIDEAITLLEQNNWDLVAAINGVIPQENGILQSEYGGETIPGPA
FNPASHPASAPTSSSSSAFRPVMPSRQIVERQPRMLDFRVEYRDRNVDVVLEDTCTVGEIKQILE
NELQIPVSKMLLKGWKTGDVEDSTVLKSLHLPKNNSLYVLTPDLPPPSSSSHAGALQESLNQNFM
LIITHREVQREYNLNFSGSSTIQEVKRNVYDLTSIPVRHQLWEGWPTSATDDSMCLAESGLSYPC
HRLTVGRRSSPAQTREQSEEQITDVHMVSDSDGDDFEDATEFGVDDGEVFGMASSALRKSPMMPE
NAENEGDALLQFTAEFSSRYGDCHPVFFIGSLEAAFQEAFYVKARDRKLLAIYLHHDESVLTNVF
CSQMLCAESIVSYLSQNFITWAWDLTKDSNRARFLTMCNRHFGSVVAQTIRTQKTDQFPLFLIIM
GKRSSNEVLNVIQGNTTVDELMMRLMAAMEIFTAQQQEDIKDEDEREARENVKREQDEAYRLSLE
ADRAKREAHEREMAEQFRLEQIRKEQEEEREAIRLSLEQALPPEPKEENAEPVSKLRIRTPSGEF
LERRFLASNKLQIVFDFVASKGFPWDEYKLLSTFPRRDVTQLDPNKSLLEVKLFPQETLFLEAKE
Calculated Isoelectric Point:
4.81
Molecular Weight:
73.95
Last Updated:
11/14/2012

Links

Characterization Data

Gel

Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding.
Click to enlarge

CPTC-FAF1 SDS PAGE

PAGE of FAF1 (rAg 10820) with molecular weight standards in lane 1

SOPs

Adobe Reader™ required.

Get Adobe Reader for free at Adobe.com