Skip to Content

Ezrin (p81)

Antibody: CPTC-Ezrin-1

Background

Catalog Number:
CPTC-Ezrin-1
Target Antigen:
Ezrin (p81)
Isotype:
IgG2b
Species:
Mouse
Last Updated:
01/24/2013
Antigen Recognition(s):

Purchase

External Links

Characterization Data [Compare Characterization Data]

Western Blot

Click to enlarge image Western Blot using CPTC-Erzin-1 as primary Ab against Ag 10474 (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).
Click to enlarge

CPTC-Ezrin-1 Western Blot

Western Blot using CPTC-Erzin-1 as primary Ab against Ag 10474 (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).

Cell Lysate Western Blot

Click to enlarge image Western Blot using CPTC-Ezrin-1 as primary Ab against cell lysate from OVCAR-3 cells (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).
Click to enlarge

CPTC-Ezrin-1 Cell Lysate Western blot

Western Blot using CPTC-Ezrin-1 as primary Ab against cell lysate from OVCAR-3 cells (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).

Indirect ELISA

Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate)
Click to enlarge

CPTC-Ezrin-1 Indirect ELISA

Indirect ELISA (ie, binding of Antibody to Antigen coated plate)

NCI 60 Protein Array

Click to enlarge image Protein Array in which CPTC-Erzin-1 is screened against the NCI60 cell line panel for expression. Data is normalized to a mean signal of 1.0 and standard deviation of 0.5.
Click to enlarge

CPTC-Ezrin-1 NCI60 Protein Array

Protein Array in which CPTC-Erzin-1 is screened against the NCI60 cell line panel for expression. Data is normalized to a mean signal of 1.0 and standard deviation of 0.5.

IHC NCI60

Click to enlarge image Immuno-histochemistry of CPTC-Erzin-1 for NCI60  Cell Line Array at titer 1:4000
0=NEGATIVE
1=WEAK(red)
2=MODERATE(blue)
3=STRONG(green)
Click to enlarge

CPTC-Ezrin-1 IHC NCI60

Immuno-histochemistry of CPTC-Erzin-1 for NCI60 Cell Line Array at titer 1:4000
0=NEGATIVE
1=WEAK(red)
2=MODERATE(blue)
3=STRONG(green)

Click to view IHC NCI60 Cell Line Array example

IHC Tissue

Click to enlarge image Tissue Micro-Array(TMA) core of breast cancer showing cytoplasmic staining using Antibody CPTC-Ezrin-1. Titer: 1:4000
Click to enlarge

CPTC-Ezrin-1 IHC Tissue

Tissue Micro-Array(TMA) core of breast cancer showing cytoplasmic staining using Antibody CPTC-Ezrin-1. Titer: 1:4000

IHC HPA

Download CPTC-Ezrin-1.pdf (110.7 KB)

CPTC-Ezrin-1 Evaluation by the Human Protein Atlas

This PDF contains the evaluation results provided by the Human Protein Atlas (www.proteinatlas.org)

Antigen: Ezrin (p81)

Background

NCI Identification Number:
10474
Antigen Name:
Ezrin (p81)
CPTC Name:
CPTC-Ezrin
Keywords:
EZR; CVIL; CVL; Cytovillin; DKFZp762H157; FLJ26216; MGC1584; OTTHUMP00000017506; OTTHUMP00000017507; VIL2; Villin-2; ezrin; p81
Function:
The cytoplasmic peripheral membrane protein encoded by this gene functions as a protein-tyrosine kinase substrate in microvilli. As a member of the ERM protein family, this protein serves as an intermediate between the plasma membrane and the actin cytoskeleton. This protein plays a key role in cell surface structure adhesion, migration and organization, and it has been implicated in various human cancers. A pseudogene located on chromosome 3 has been identified for this gene.
Alternatively spliced variants have also been described for this gene. Probably involved in connections of major cytoskeletal structures to the plasma membrane.

In epithelial cells, required for the formation of microvilli and membrane ruffles on the apical pole. Along with PLEKHG6, required for normal macropinocytosis.
Chromosomal Localization:
P15311
Expression System:
E. Coli
NCBI Accession Number:
BC013903
Swiss Prot Accession Number:
P15311
DNA Source:
HIP:HsCD00041738
Immunogen:
Recombinant Full Length Protein
Vector Name:
pMCSG7
Extinction Coefficient:
66873
Buffers:
50mM NH4HC03
Expressed Sequence:
SNAMPKPINVRVTTMDAELEFAIQPNTTGKQLFDQVVKTIGLREVWYFGLHYVDNKGFP
TWLKLDKKVSAQEVRKENPLQFKFRAKFYPEDVAEELIQDITQKLFFLQVKEGILSDEI
YCPPETAVLLGSYAVQAKFGDYNKEVHKSGYLSSERLIPQRVMDQHKLTRDQWEDRIQV
WHAEHRGMLKDNAMLEYLKIAQDLEMYGINYFEIKNKKGTDLWLGVDALGLNIYEKDDK
LTPKIGFPWSEIRNISFNDKKFVIKPIDKKAPDFVFYAPRLRINKRILQLCMGNHELYM
RRRKPDTIEVQQMKAQAREEKHQKQLERQQLETEKKRRETVEREKEQMMREKEELMLRL
QDYEEKTKKAERELSEQIQRALQLEEERKRAQEEAERLEADRMAALRAKEELERQAVDQ
IKSQEQLAAELAEYTAKIALLEEARRRKEDEVEEWQHRAKEAQDDLVKTKEELHLVMTA
PPPPPPPVYEPVSYHVQESLQDEGAEPTGYSAELSSEGIRDDRNEEKRITEAEKNERVQ
RQLLTLSSELSQARDENKRTHNDIIHNENMRQGRDKYKTLRQIRQGNTKQRIDEFEAL
Native Sequence:
MPKPINVRVTTMDAELEFAIQPNTTGKQLFDQVVKTIGLREVWYFGLHYVDNKGFPTWL
KLDKKVSAQEVRKENPLQFKFRAKFYPEDVAEELIQDITQKLFFLQVKEGILSDEIYCP
PETAVLLGSYAVQAKFGDYNKEVHKSGYLSSERLIPQRVMDQHKLTRDQWEDRIQVWHA
EHRGMLKDNAMLEYLKIAQDLEMYGINYFEIKNKKGTDLWLGVDALGLNIYEKDDKLTP
KIGFPWSEIRNISFNDKKFVIKPIDKKAPDFVFYAPRLRINKRILQLCMGNHELYMRRR
KPDTIEVQQMKAQAREEKHQKQLERQQLETEKKRRETVEREKEQMMREKEELMLRLQDY
EEKTKKAERELSEQIQRALQLEEERKRAQEEAERLEADRMAALRAKEELERQAVDQIKS
QEQLAAELAEYTAKIALLEEARRRKEDEVEEWQHRAKEAQDDLVKTKEELHLVMTAPPP
PPPPVYEPVSYHVQESLQDEGAEPTGYSAELSSEGIRDDRNEEKRITEAEKNERVQRQL
LTLSSELSQARDENKRTHNDIIHNENMRQGRDKYKTLRQIRQGNTKQRIDEFEAL
Calculated Isoelectric Point:
5.94
Molecular Weight:
69685
Last Updated:
04/12/2013

Links

Characterization Data

Gel

Click to enlarge image Tissue Micro-Array(TMA) core of breast cancer showing cytoplasmic staining using Antibody CPTC-Ezrin-1. Titer: 1:4000
Click to enlarge

Ag 10474 PAGE

PAGE of Ag 10474 (with molecular weight standards in lane 1)

SOPs

Adobe Reader™ required.

Get Adobe Reader for free at Adobe.com