Skip to Content

Estrogen Receptor Binding Site Associated, Antigen 9

Antibody: CPTC-EBAG9-1

Background

Catalog Number:
CPTC-EBAG9-1
Target Antigen:
Estrogen Receptor Binding Site Associated, Antigen 9
Isotype:
IgG2a
Species:
Mouse
Last Updated:
06/12/2014
Antigen Recognition(s):
recombinant full-length

Purchase

Characterization Data [Compare Characterization Data]

Western Blot

Click to enlarge image Western Blot using CPTC-EBAG9-1 as primary Ab against EBAG9 (rAg 10772) in lane 3. Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 2).
Click to enlarge

CPTC-EBAG9-1 Western blot

Western Blot using CPTC-EBAG9-1 as primary Ab against EBAG9 (rAg 10772) in lane 3. Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 2).

Indirect ELISA

Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding.
Click to enlarge

CPTC-EBAG9-1 Indirect ELISA

Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding.

NCI 60 Protein Array

CPTC-EBAG9-1NCI 60 Protein Array

This antibody is not suitable for use in a Reverse Phase Protein Array format as described in SOP M-105.

Antibody: CPTC-EBAG9-2

Background

Catalog Number:
CPTC-EBAG9-2
Target Antigen:
Estrogen Receptor Binding Site Associated, Antigen 9
Isotype:
IgG2a
Species:
Mouse
Last Updated:
04/29/2014
Antigen Recognition(s):
recombinant full-length

Purchase

Characterization Data [Compare Characterization Data]

Western Blot

Click to enlarge image Western Blot using CPTC-EBAG9-2 as primary Ab against EBAG9 (rAg 10772) in lane 3. Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 2).
Click to enlarge

CPTC-EBAG9-2 Western blot

Western Blot using CPTC-EBAG9-2 as primary Ab against EBAG9 (rAg 10772) in lane 3. Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 2).

Indirect ELISA

Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding.
Click to enlarge

CPTC-EBAG9-2 Indirect ELISA

Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding.

Antibody: CPTC-EBAG9-3

Background

Catalog Number:
CPTC-EBAG9-3
Target Antigen:
Estrogen Receptor Binding Site Associated, Antigen 9
Isotype:
IgG1
Species:
Mouse
Last Updated:
04/02/2014
Antigen Recognition(s):
recombinant full-length

Purchase

Characterization Data [Compare Characterization Data]

Western Blot

Click to enlarge image Western Blot using CPTC-EBAG9-3 as primary Ab against EBAG9 (rAg 10772) in lane 3. Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 2).
Click to enlarge

CPTC-EBAG9-3 Western blot

Western Blot using CPTC-EBAG9-3 as primary Ab against EBAG9 (rAg 10772) in lane 3. Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 2).

Indirect ELISA

Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding.
Click to enlarge

CPTC-EBAG9-3 Indirect ELISA

Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding.

NCI 60 Protein Array

CPTC-EBAG9-3 NCI 60 Protein Array

This antibody is not suitable for use in a Reverse Phase Protein Array format as described in SOP M-105.

IHC NCI60

CPTC-EBAG9-3 IHC NCI60

This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.

Click to view IHC NCI60 Cell Line Array example

IHC Tissue

CPTC-EBAG9-3 IHC Tissue

This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.

Antigen: Estrogen Receptor Binding Site Associated, Antigen 9

Background

NCI Identification Number:
10772
Antigen Name:
Estrogen Receptor Binding Site Associated, Antigen 9
CPTC Name:
CPTC-EBAG9
Keywords:
EB9; PDAF; RCAS1
Function:
This gene was identified as an estrogen-responsive gene. Regulation of transcription by estrogen is mediated by estrogen receptor which binds to the estrogen-responsive element (ERE) found in the 5'-flanking region of this gene. The encoded protein is a tumor-associated antigen that is expressed at high frequency in a variety of cancers. Two transcript variants differing in the 5' UTR, but encoding the same protein, have been identified for this gene.

May participate in suppression of cell proliferation and induces apoptotic cell death through activation of interleukin-1-beta converting enzyme (ICE)-like proteases.
Chromosomal Localization:
8q23
Expression System:
E. Coli
NCBI Accession Number:
BC017729.1
Swiss Prot Accession Number:
O00559
DNA Source:
HIP : HsCD00040328
Immunogen:
Recombinant Full Length Protein
Vector Name:
pMCSG7
Extinction Coefficient:
30480
Buffers:
PBS
Expressed Sequence:
SNAGRGRKLSGDQITLPTTVDYSSVPKQTDVEEWTSW
DEDAPTSVKIEGGNGNVATQQNSLEQLEPDYFKDMTP
TIRKTQKIVIKKRPLNFGIPDGSTGFSSRLAATQDLP
FIHQSSELGDLDTWQENTNAWEEEEDAAWQAEEVLRQ
QKLADREKRAAEQQRKKMEKEAQRMKKEQNKIGVKLS
Native Sequence:
MAITQFRLFKFCTCLATVFSFLKRLICRSGRGRKLSGDQITLP
TTVDYSSVPKQTDVEEWTSWDEDAPTSVKIEGGNGNVATQQNS
LEQLEPDYFKDMTPTIRKTQKIVIKKREPLNFGIPDGSTGFSS
RLAATQDLPFIHQSSELGDLDTWQENTNAWEEEEDAAWQAEEV
LRQQKLADREKRAAEQQRKKMEKEAQRLMKKEQNKIGVKLS
Calculated Isoelectric Point:
5.06
Molecular Weight:
20.95
Last Updated:
11/14/2012

Links

Characterization Data

Gel

Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding.
Click to enlarge

CPTC-EBAG9 PAGE

PAGE of EBAG9 (rAg 10772) with molecular weight standards (lane 1)

SOPs

Adobe Reader™ required.

Get Adobe Reader for free at Adobe.com