Skip to Content

Chloride Intracellular Channel 1

Antibody: CPTC-CLIC1-1

Background

Catalog Number:
CPTC-CLIC1-1
Target Antigen:
Chloride Intracellular Channel 1
Isotype:
IgG2a
Species:
Mouse
Last Updated:
02/28/2013
Antigen Recognition(s):
recombinant full-length

Purchase

External Links

Characterization Data [Compare Characterization Data]

Western Blot

Click to enlarge image Western Blot using CPTC-CLIC1-1 as primary Ab against Ag 10458 (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).
Click to enlarge

CPTC-CLIC1-1 Western Blot

Western Blot using CPTC-CLIC1-1 as primary Ab against Ag 10458 (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).

Indirect ELISA

Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate)
Click to enlarge

CPTC-CLIC1-1 Indirect ELISA

Indirect ELISA (ie, binding of Antibody to Antigen coated plate)

NCI 60 Protein Array

Click to enlarge image Protein Array in which CPTC-CLIC1-1 is screened against the NCI60 cell line panel for expression. Data is normalized to a mean signal of 1.0 and standard deviation of 0.5. Color conveys over-expression level (green), basal level (blue), under-expression level (red).
Click to enlarge

CPTC-CLIC1-1 NCI60 Protein Array

Protein Array in which CPTC-CLIC1-1 is screened against the NCI60 cell line panel for expression. Data is normalized to a mean signal of 1.0 and standard deviation of 0.5. Color conveys over-expression level (green), basal level (blue), under-expression level (red).

IHC NCI60

Click to enlarge image Immuno-histochemistry of CPTC-CLIC1-1 for NCI60  Cell Line Array at titer 1:250
0=NEGATIVE
1=WEAK(red)
2=MODERATE(blue)
3=STRONG(green)
Click to enlarge

CPTC-CLIC1-1 IHC NCI60

Immuno-histochemistry of CPTC-CLIC1-1 for NCI60 Cell Line Array at titer 1:250
0=NEGATIVE
1=WEAK(red)
2=MODERATE(blue)
3=STRONG(green)

Click to view IHC NCI60 Cell Line Array example

IHC Tissue

Click to enlarge image Tissue Micro-Array(TMA) core of ovarian cancer showing cytoplasmic staining using Antibody CPTC-CLIC1-1. Titer: 1:250
Click to enlarge

CPTC-CLIC1-1 IHC Tissue

Tissue Micro-Array(TMA) core of ovarian cancer showing cytoplasmic staining using Antibody CPTC-CLIC1-1. Titer: 1:250

Antibody: CPTC-CLIC1-2

Background

Catalog Number:
CPTC-CLIC1-2
Target Antigen:
Chloride Intracellular Channel 1
Isotype:
IgG1
Species:
Mouse
Last Updated:
12/15/2011
Antigen Recognition(s):
recombinant full-length

Purchase

Characterization Data [Compare Characterization Data]

Western Blot

Click to enlarge image Western Blot using CPTC-CLIC1-2 as primary Ab against Ag 10458 (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).
Click to enlarge

CPTC-CLIC1-2 Western Blot

Western Blot using CPTC-CLIC1-2 as primary Ab against Ag 10458 (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).

Indirect ELISA

Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate)
Click to enlarge

CPTC-CLIC1-2 Indirect ELISA

Indirect ELISA (ie, binding of Antibody to Antigen coated plate)

NCI 60 Protein Array

Click to enlarge image Protein Array in which CPTC-CLIC1-2 is screened against the NCI60 cell line panel for expression. Data is normalized to a mean signal of 1.0 and standard deviation of 0.5. Color conveys over-expression level (green), basal level (blue), under-expression level (red).
Click to enlarge

CPTC-CLIC1-2 Protein Array

Protein Array in which CPTC-CLIC1-2 is screened against the NCI60 cell line panel for expression. Data is normalized to a mean signal of 1.0 and standard deviation of 0.5. Color conveys over-expression level (green), basal level (blue), under-expression level (red).

IHC NCI60

Click to enlarge image Immunohistochemistry of CPTC-CLIC1-2 for NCI60 Cell Line Array. Data scored as:
0=NEGATIVE
1=WEAK (red)
2=MODERATE (blue)
3=STRONG (green)
Titer: 1:250
Click to enlarge

CPTC-CLIC1-2 IHC NCI60

Immunohistochemistry of CPTC-CLIC1-2 for NCI60 Cell Line Array. Data scored as:
0=NEGATIVE
1=WEAK (red)
2=MODERATE (blue)
3=STRONG (green)
Titer: 1:250

Click to view IHC NCI60 Cell Line Array example

IHC Tissue

Click to enlarge image Tissue Micro-Array(TMA) core of ovarian cancer showing cytoplasmic staining using Antibody CPTC-CLIC1-2. Titer: 1:250
Click to enlarge

CPTC-CLIC1-2 IHC Tissue

Tissue Micro-Array(TMA) core of ovarian cancer showing cytoplasmic staining using Antibody CPTC-CLIC1-2. Titer: 1:250

Antigen: Chloride Intracellular Channel 1

Background

NCI Identification Number:
10458
Antigen Name:
Chloride Intracellular Channel 1
CPTC Name:
CPTC-CLIC1
Keywords:
CLIC1; G6; NCC27; OTTHUMP00000029131; OTTHUMP00000029133; OTTHUMP00000029137; OTTHUMP00000174486; hRNCC; p64CLCP
Function:
Chloride channels are a diverse group of proteins that regulate fundamental cellular processes
including stabilization of cell membrane potential,transepithelial transport, maintenance of
intracellular pH, and regulation of cell volume. Chloride intracellular channel 1 is a member of the p64 family; the protein localizes principally to the cell nucleus and exhibits both nuclear and plasma membrane chloride ion channel activity.
Chromosomal Localization:
6p22.1 - p21.2
Expression System:
E. Coli
NCBI Accession Number:
NM_001288
Swiss Prot Accession Number:
O00299
DNA Source:
HIP:HsCD00001712
Immunogen:
Recombinant Full Length Protein
Vector Name:
pMCSG7
Extinction Coefficient:
17608
Buffers:
50mM NH4HC03
Expressed Sequence:
SNAMAEEQPQVELFVKAGSDGAKIGNCPFSQRLFMVLWLKGVTFNVTTV
DTKRRTETVQKLCPGGQLPFLLYGTEVHTDTNKIEEFLEAVLCPPRYPK
LAALNPESNTAGLDIFAKFSAYIKNSNPALNDNLEKGLLKALKVLDNYL
TSPLPEEVDETSAEDEGVSQRKFLDGNELTLADCNLLPKLHIVQVVCKK
YRGFTIPEAFRGVHRYLSNAYAREEFASTCPDDEEIELAYEQVAKALK
Native Sequence:
MAEEQPQVELFVKAGSDGAKIGNCPFSQRLFMVLWLKGVTFNVTTVDTK
RRTETVQKLCPGGQLPFLLYGTEVHTDTNKIEEFLEAVLCPPRYPKLAA
LNPESNTAGLDIFAKFSAYIKNSNPALNDNLEKGLLKALKVLDNYLTSP
LPEEVDETSAEDEGVSQRKFLDGNELTLADCNLLPKLHIVQVVCKKYRG
FTIPEAFRGVHRYLSNAYAREEFASTCPDDEEIELAYEQVAKALK
Calculated Isoelectric Point:
5.09
Molecular Weight:
27195
Last Updated:
04/09/2013

Links

Characterization Data

Gel

Click to enlarge image Tissue Micro-Array(TMA) core of ovarian cancer showing cytoplasmic staining using Antibody CPTC-CLIC1-2. Titer: 1:250
Click to enlarge

CPTC-CLIC1 (rAg 10458) PAGE

PAGE of CLIC1 (rAg 10458) with molecular weight standards in lane 1.

SOPs

Adobe Reader™ required.

Get Adobe Reader for free at Adobe.com